BLASTX nr result
ID: Ophiopogon22_contig00026846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026846 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008789606.1| PREDICTED: calcium-transporting ATPase 8, pl... 58 4e-07 gb|ONK69554.1| uncharacterized protein A4U43_C05F24190 [Asparagu... 56 2e-06 ref|XP_020266745.1| calcium-transporting ATPase 8, plasma membra... 56 2e-06 ref|XP_021315082.1| calcium-transporting ATPase 8, plasma membra... 52 4e-06 ref|XP_021315074.1| calcium-transporting ATPase 8, plasma membra... 52 5e-06 >ref|XP_008789606.1| PREDICTED: calcium-transporting ATPase 8, plasma membrane-type-like [Phoenix dactylifera] Length = 1063 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 97 DAEVHIHWKEAAELVLASCTCWLDTDGLVQLM 2 D+EVH+HWK AAE+VLA+CT WLD DGLVQ M Sbjct: 595 DSEVHVHWKGAAEIVLAACTSWLDADGLVQPM 626 >gb|ONK69554.1| uncharacterized protein A4U43_C05F24190 [Asparagus officinalis] Length = 1009 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 97 DAEVHIHWKEAAELVLASCTCWLDTDGLVQLM 2 D + HIHWK AAELVLA CT WLDTDGLVQ M Sbjct: 528 DGKTHIHWKGAAELVLALCTFWLDTDGLVQEM 559 >ref|XP_020266745.1| calcium-transporting ATPase 8, plasma membrane-type-like [Asparagus officinalis] Length = 1136 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 97 DAEVHIHWKEAAELVLASCTCWLDTDGLVQLM 2 D + HIHWK AAELVLA CT WLDTDGLVQ M Sbjct: 655 DGKTHIHWKGAAELVLALCTFWLDTDGLVQEM 686 >ref|XP_021315082.1| calcium-transporting ATPase 8, plasma membrane-type-like isoform X3 [Sorghum bicolor] gb|KXG38760.1| hypothetical protein SORBI_3001G275900 [Sorghum bicolor] Length = 124 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 97 DAEVHIHWKEAAELVLASCTCWLDTDGLVQLM 2 D EVHIHWK AAE++LASC WL TDG VQ M Sbjct: 33 DTEVHIHWKGAAEVLLASCRSWLSTDGSVQPM 64 >ref|XP_021315074.1| calcium-transporting ATPase 8, plasma membrane-type-like isoform X1 [Sorghum bicolor] ref|XP_021315080.1| calcium-transporting ATPase 8, plasma membrane-type-like isoform X2 [Sorghum bicolor] Length = 127 Score = 52.4 bits (124), Expect = 5e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 97 DAEVHIHWKEAAELVLASCTCWLDTDGLVQLM 2 D EVHIHWK AAE++LASC WL TDG VQ M Sbjct: 36 DTEVHIHWKGAAEVLLASCRSWLSTDGSVQPM 67