BLASTX nr result
ID: Ophiopogon22_contig00026195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026195 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 67 2e-12 gb|POF10258.1| putative serine/threonine-protein kinase wnk4 [Qu... 55 5e-06 gb|POF10259.1| putative serine/threonine-protein kinase wnk4 [Qu... 55 5e-06 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 67.4 bits (163), Expect = 2e-12 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 127 DFSRASV-IEMAWIMLRIDYSRLFWLLFRVFSYENHEGKPRI 5 +FSR +V + + WIMLRIDYSRL WLLF VFSYENHEGKPRI Sbjct: 19 EFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRI 60 >gb|POF10258.1| putative serine/threonine-protein kinase wnk4 [Quercus suber] Length = 689 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 145 MFDRCSDFSRASVIEMAWIMLRIDYSRLFWLLF 47 MF + DFSRA V+EMAWIMLRIDYSRLFWLLF Sbjct: 1 MFAKNYDFSRA-VVEMAWIMLRIDYSRLFWLLF 32 >gb|POF10259.1| putative serine/threonine-protein kinase wnk4 [Quercus suber] Length = 704 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 145 MFDRCSDFSRASVIEMAWIMLRIDYSRLFWLLF 47 MF + DFSRA V+EMAWIMLRIDYSRLFWLLF Sbjct: 1 MFAKNYDFSRA-VVEMAWIMLRIDYSRLFWLLF 32