BLASTX nr result
ID: Ophiopogon22_contig00026134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026134 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256563.1| TBC1 domain family member 17-like [Asparagus... 90 1e-18 gb|POE80480.1| tbc1 domain family member 15 [Quercus suber] 83 5e-16 gb|PKI67662.1| hypothetical protein CRG98_011875 [Punica granatum] 75 4e-15 gb|KHN46534.1| GTPase-activating protein gyp7 [Glycine soja] 75 4e-15 ref|XP_020095182.1| TBC1 domain family member 15-like [Ananas co... 80 4e-15 ref|XP_020096673.1| TBC1 domain family member 15-like [Ananas co... 80 4e-15 ref|XP_015089468.1| PREDICTED: TBC1 domain family member 15 isof... 80 4e-15 ref|XP_010327165.1| PREDICTED: TBC1 domain family member 15 isof... 80 4e-15 ref|XP_010327163.1| PREDICTED: TBC1 domain family member 15 isof... 80 4e-15 ref|XP_015089465.1| PREDICTED: TBC1 domain family member 15 isof... 80 4e-15 ref|XP_023876965.1| TBC1 domain family member 17-like [Quercus s... 80 8e-15 gb|KVH88419.1| Rab-GTPase-TBC domain-containing protein [Cynara ... 79 9e-15 gb|PLY85156.1| hypothetical protein LSAT_0X6780 [Lactuca sativa] 79 1e-14 ref|XP_023764246.1| GTPase-activating protein GYP7-like isoform ... 79 1e-14 ref|XP_016470744.1| PREDICTED: TBC1 domain family member 15-like... 79 1e-14 ref|XP_009632061.1| PREDICTED: TBC1 domain family member 15-like... 79 1e-14 gb|PHU04144.1| hypothetical protein BC332_24966 [Capsicum chinense] 79 1e-14 gb|PHT69604.1| hypothetical protein T459_24708 [Capsicum annuum] 79 1e-14 gb|PHT35432.1| hypothetical protein CQW23_23132 [Capsicum baccatum] 79 1e-14 ref|XP_016545878.1| PREDICTED: GTPase-activating protein gyp7-li... 79 1e-14 >ref|XP_020256563.1| TBC1 domain family member 17-like [Asparagus officinalis] gb|ONK74755.1| uncharacterized protein A4U43_C03F9820 [Asparagus officinalis] Length = 441 Score = 90.1 bits (222), Expect = 1e-18 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 MWRDPGLPTDSFYEVR EC DVPKTNFKIKNGKTLSQRRWQA Sbjct: 1 MWRDPGLPTDSFYEVRAECNDVPKTNFKIKNGKTLSQRRWQA 42 >gb|POE80480.1| tbc1 domain family member 15 [Quercus suber] Length = 445 Score = 83.2 bits (204), Expect = 5e-16 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +1 Query: 250 LEMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 LEMWRDPG P DS+Y+VRPEC DVPKT FKIK+GKTLS R+WQA Sbjct: 4 LEMWRDPGTPADSYYQVRPECTDVPKTRFKIKSGKTLSVRKWQA 47 >gb|PKI67662.1| hypothetical protein CRG98_011875 [Punica granatum] Length = 97 Score = 75.1 bits (183), Expect = 4e-15 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRW 375 MWRDPG P DSFY+VRPEC DVPKT FKIK G+TLS R+W Sbjct: 1 MWRDPGAPADSFYKVRPECTDVPKTRFKIKAGRTLSARKW 40 >gb|KHN46534.1| GTPase-activating protein gyp7 [Glycine soja] Length = 97 Score = 75.1 bits (183), Expect = 4e-15 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 MWRDPG P DSFYE RPEC DVPK+ F+IK GKTLS R+W A Sbjct: 1 MWRDPGAPADSFYETRPECTDVPKSRFRIKAGKTLSARKWNA 42 >ref|XP_020095182.1| TBC1 domain family member 15-like [Ananas comosus] Length = 443 Score = 80.5 bits (197), Expect = 4e-15 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 MWRD G PTDSFY VRPECADVPKT FKIK GKTLS RRWQA Sbjct: 1 MWRDSGAPTDSFYAVRPECADVPKTKFKIKAGKTLSARRWQA 42 >ref|XP_020096673.1| TBC1 domain family member 15-like [Ananas comosus] gb|OAY67284.1| TBC1 domain family member 15 [Ananas comosus] Length = 443 Score = 80.5 bits (197), Expect = 4e-15 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 MWRD G PTDSFY VRPECADVPKT FKIK GKTLS RRWQA Sbjct: 1 MWRDSGAPTDSFYAVRPECADVPKTKFKIKAGKTLSARRWQA 42 >ref|XP_015089468.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Solanum pennellii] Length = 447 Score = 80.5 bits (197), Expect = 4e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS+R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSERKWRA 50 >ref|XP_010327165.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Solanum lycopersicum] Length = 450 Score = 80.5 bits (197), Expect = 4e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS+R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSERKWRA 50 >ref|XP_010327163.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Solanum lycopersicum] Length = 451 Score = 80.5 bits (197), Expect = 4e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS+R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSERKWRA 50 >ref|XP_015089465.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Solanum pennellii] ref|XP_015089466.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Solanum pennellii] ref|XP_015089467.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Solanum pennellii] Length = 452 Score = 80.5 bits (197), Expect = 4e-15 Identities = 32/43 (74%), Positives = 39/43 (90%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS+R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSERKWRA 50 >ref|XP_023876965.1| TBC1 domain family member 17-like [Quercus suber] Length = 440 Score = 79.7 bits (195), Expect = 8e-15 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 MWRDPG P DS+Y+VRPEC DVPKT FKIK+GKTLS R+WQA Sbjct: 1 MWRDPGTPADSYYQVRPECTDVPKTRFKIKSGKTLSVRKWQA 42 >gb|KVH88419.1| Rab-GTPase-TBC domain-containing protein [Cynara cardunculus var. scolymus] Length = 389 Score = 79.3 bits (194), Expect = 9e-15 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +W+DPGLPTDSFYEVR EC DVPKT FKIK+GKTLS R+WQ+ Sbjct: 4 LWKDPGLPTDSFYEVRAECTDVPKTKFKIKSGKTLSVRKWQS 45 >gb|PLY85156.1| hypothetical protein LSAT_0X6780 [Lactuca sativa] Length = 437 Score = 79.3 bits (194), Expect = 1e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +W+DPGLPTDSFYEVR EC DVPKT FKIK+GKTLS R+WQ+ Sbjct: 4 LWKDPGLPTDSFYEVRAECTDVPKTKFKIKSGKTLSVRKWQS 45 >ref|XP_023764246.1| GTPase-activating protein GYP7-like isoform X2 [Lactuca sativa] Length = 443 Score = 79.3 bits (194), Expect = 1e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +1 Query: 256 MWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +W+DPGLPTDSFYEVR EC DVPKT FKIK+GKTLS R+WQ+ Sbjct: 4 LWKDPGLPTDSFYEVRAECTDVPKTKFKIKSGKTLSVRKWQS 45 >ref|XP_016470744.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tabacum] Length = 447 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50 >ref|XP_009632061.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis] Length = 447 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50 >gb|PHU04144.1| hypothetical protein BC332_24966 [Capsicum chinense] Length = 455 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50 >gb|PHT69604.1| hypothetical protein T459_24708 [Capsicum annuum] Length = 455 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50 >gb|PHT35432.1| hypothetical protein CQW23_23132 [Capsicum baccatum] Length = 455 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50 >ref|XP_016545878.1| PREDICTED: GTPase-activating protein gyp7-like [Capsicum annuum] Length = 455 Score = 79.3 bits (194), Expect = 1e-14 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +1 Query: 253 EMWRDPGLPTDSFYEVRPECADVPKTNFKIKNGKTLSQRRWQA 381 +MWRDPG P DSFY+VRPEC DVPK+ F+IKNGKTLS R+W+A Sbjct: 8 KMWRDPGAPADSFYQVRPECTDVPKSKFRIKNGKTLSARKWRA 50