BLASTX nr result
ID: Ophiopogon22_contig00026129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00026129 (778 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA58568.1| hypothetical protein AXF42_Ash008855 [Apostasia s... 55 5e-06 ref|XP_020533174.1| zinc finger MYM-type protein 1-like [Jatroph... 57 7e-06 ref|XP_023897005.1| zinc finger MYM-type protein 1-like [Quercus... 57 9e-06 >gb|PKA58568.1| hypothetical protein AXF42_Ash008855 [Apostasia shenzhenica] Length = 111 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -3 Query: 512 GLKTLAMQQNISTYYVHCLTHQLQ*TPIVIVKNHVQIASSFS 387 GLK+L + +N S +YVHC HQLQ T + + KNH+Q+AS F+ Sbjct: 7 GLKSLILSENPSAFYVHCFAHQLQLTLVAVAKNHIQVASFFN 48 >ref|XP_020533174.1| zinc finger MYM-type protein 1-like [Jatropha curcas] Length = 337 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 518 IIGLKTLAMQQNISTYYVHCLTHQLQ*TPIVIVKNHVQIASSFS 387 I GLK+L +++N STYYVHC HQLQ +V+ KNHVQIA F+ Sbjct: 115 INGLKSLMLKENSSTYYVHCFAHQLQLALVVVTKNHVQIALLFN 158 >ref|XP_023897005.1| zinc finger MYM-type protein 1-like [Quercus suber] Length = 487 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -3 Query: 521 RIIGLKTLAMQQNISTYYVHCLTHQLQ*TPIVIVKNHVQIASSFS 387 ++ GLKTL ++ N S YYVHC HQLQ T + I KNH+QIA+ F+ Sbjct: 110 KLNGLKTLILKDNPSAYYVHCFAHQLQLTLVAIAKNHIQIATFFN 154