BLASTX nr result
ID: Ophiopogon22_contig00024469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00024469 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264013.1| uncharacterized protein LOC109839951 [Aspara... 62 2e-08 ref|XP_020267038.1| uncharacterized protein LOC109842592 [Aspara... 55 4e-06 >ref|XP_020264013.1| uncharacterized protein LOC109839951 [Asparagus officinalis] Length = 344 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/58 (44%), Positives = 40/58 (68%) Frame = +1 Query: 4 ESRKKDPTWKYTILRKPLDTLKHNCPFCDKSSHGGITRANEHLIDTSKSTRTSSFINK 177 + R++DPTWKYT L + ++ KH C +C+K ++GGI+R EHLI T++ + S NK Sbjct: 11 KGRRQDPTWKYTSLVEEGNSNKHKCIYCNKITNGGISRQKEHLIGTTRKRKNVSLCNK 68 >ref|XP_020267038.1| uncharacterized protein LOC109842592 [Asparagus officinalis] Length = 643 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = +1 Query: 10 RKKDPTWKYTILRKPLDTLKHNCPFCDKSSHGGITRANEHLIDTSKSTRTSSFINK 177 R++D TWKYT L + ++ KH C +C+K ++ GI+R EHLI T++ + S NK Sbjct: 13 RRQDSTWKYTSLVEEGNSNKHKCIYCNKITNDGISRQKEHLIGTTRKRKNVSLCNK 68