BLASTX nr result
ID: Ophiopogon22_contig00022766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022766 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254341.1| pentatricopeptide repeat-containing protein ... 64 3e-09 >ref|XP_020254341.1| pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Asparagus officinalis] Length = 772 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -1 Query: 265 MKRAKNKQLMLEDYLSFFDNLRPGDLTVDHLNQILSIHGCCKRKTK 128 M RA++KQLM EDYLSFF+N P LT+D LN+ILSIH C+ KTK Sbjct: 1 MNRARSKQLMFEDYLSFFENPDPRSLTMDQLNKILSIHAWCRLKTK 46