BLASTX nr result
ID: Ophiopogon22_contig00022616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022616 (607 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ69297.1| putative UDP-sugar transporter [Zostera marina] 56 7e-06 ref|XP_010268354.1| PREDICTED: putative UDP-sugar transporter DD... 56 9e-06 ref|XP_010268352.1| PREDICTED: putative UDP-sugar transporter DD... 56 1e-05 ref|XP_020264756.1| putative UDP-sugar transporter DDB_G0278631 ... 56 1e-05 >gb|KMZ69297.1| putative UDP-sugar transporter [Zostera marina] Length = 325 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 IAGIGDFSFDLFGYSMALTSVFFQTDYFVL 92 IAG+GDFSFDLFGYSMALTSVFFQT Y +L Sbjct: 146 IAGLGDFSFDLFGYSMALTSVFFQTMYLLL 175 >ref|XP_010268354.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform X2 [Nelumbo nucifera] Length = 291 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 IAGIGDFSFDLFGYSMALTSVFFQTDYFVL 92 IA +GDFSFDLFGYSMALTSVFFQT Y VL Sbjct: 120 IAALGDFSFDLFGYSMALTSVFFQTTYLVL 149 >ref|XP_010268352.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform X1 [Nelumbo nucifera] ref|XP_010268353.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform X1 [Nelumbo nucifera] Length = 321 Score = 55.8 bits (133), Expect = 1e-05 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 IAGIGDFSFDLFGYSMALTSVFFQTDYFVL 92 IA +GDFSFDLFGYSMALTSVFFQT Y VL Sbjct: 150 IAALGDFSFDLFGYSMALTSVFFQTTYLVL 179 >ref|XP_020264756.1| putative UDP-sugar transporter DDB_G0278631 [Asparagus officinalis] gb|ONK69659.1| uncharacterized protein A4U43_C05F25380 [Asparagus officinalis] Length = 330 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 3 IAGIGDFSFDLFGYSMALTSVFFQTDYFVL 92 IA IGDFSFDLFGYSMALTSVFFQT Y VL Sbjct: 145 IAAIGDFSFDLFGYSMALTSVFFQTMYLVL 174