BLASTX nr result
ID: Ophiopogon22_contig00022324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022324 (574 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017702375.1| PREDICTED: DNA topoisomerase 2-like isoform ... 42 1e-06 >ref|XP_017702375.1| PREDICTED: DNA topoisomerase 2-like isoform X1 [Phoenix dactylifera] Length = 176 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 299 IKQSLSLQHGKHYNSLKDLRYGSLMIMTYQV 207 IKQ L LQ GK Y S K LRYG LMIMT +V Sbjct: 9 IKQILGLQQGKEYESTKGLRYGHLMIMTDRV 39 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = -2 Query: 150 VSLFMQLVALLIHDHDSSHIKILLINLFDFFLSSQIK 40 V ++Q++ LL+ DHD SHIK LLIN F S +K Sbjct: 54 VPAYLQVLCLLVQDHDGSHIKGLLINFIHSFWPSLLK 90