BLASTX nr result
ID: Ophiopogon22_contig00022205
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022205 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241462.1| pentatricopeptide repeat-containing protein ... 65 3e-09 >ref|XP_020241462.1| pentatricopeptide repeat-containing protein At1g11900-like [Asparagus officinalis] gb|ONK61751.1| uncharacterized protein A4U43_C08F33200 [Asparagus officinalis] Length = 423 Score = 64.7 bits (156), Expect = 3e-09 Identities = 44/111 (39%), Positives = 62/111 (55%), Gaps = 14/111 (12%) Frame = -2 Query: 298 LCGSMRWIQVRSKKLHHP--------------RVSSEGKGFLIXXXXXXXXXXXXXLKCT 161 L GS+RW+Q++SK L P RVS E +G L + T Sbjct: 8 LRGSLRWVQIQSK-LQCPSSRLCSSARDRARVRVSRE-RGCLFVCNFSALSSPTP--RYT 63 Query: 160 IYAPFVDNGTVSFTASLCQLLPKHSNKRCIMTWGSVNDQKVIEDWENFLST 8 + P++ N +VS TA+L +L P+H NKR IMTWGSV +++VI+ +E FLST Sbjct: 64 AFTPYLYNDSVSDTANLFKLSPEHINKRPIMTWGSVKEEEVIQAFEKFLST 114