BLASTX nr result
ID: Ophiopogon22_contig00022173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022173 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010931403.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 1e-06 >ref|XP_010931403.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g14730 [Elaeis guineensis] Length = 635 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +3 Query: 3 VVGLGLHTFITGDQNHPEAKGIYGMLHGLVRQMRELGSVPNVFM 134 V G G+H F+TGD++HPEA+GIYG LHGL+ +MRE V +V + Sbjct: 588 VAGKGVHAFLTGDRDHPEAEGIYGALHGLIGRMRENRDVSDVML 631