BLASTX nr result
ID: Ophiopogon22_contig00021967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00021967 (888 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276463.1| uncharacterized protein LOC109850809 [Aspara... 72 9e-18 >ref|XP_020276463.1| uncharacterized protein LOC109850809 [Asparagus officinalis] gb|ONK64624.1| uncharacterized protein A4U43_C07F28110 [Asparagus officinalis] Length = 219 Score = 72.0 bits (175), Expect(2) = 9e-18 Identities = 38/71 (53%), Positives = 51/71 (71%) Frame = +1 Query: 1 HLTSPAQMGENDLVNWSVDLMNRRPGRETTSSEKPSPFCSRKVHKVSIGSITEVSDQNFL 180 H TS QM E + VN S + + R GR+ T+S++P PF S+KV+KVS+GSITEVSDQNF Sbjct: 110 HATSEDQMVEKNQVNQSNNSIYWRHGRKATTSKQPPPFFSQKVNKVSVGSITEVSDQNFA 169 Query: 181 DMDIERGERVE 213 M+ ER E ++ Sbjct: 170 YMEDERAEELK 180 Score = 47.4 bits (111), Expect(2) = 9e-18 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +3 Query: 225 AKRARTAASPITDQVVTFVPPTSEKTAFLNENNEE 329 AKRAR AAS + DQVV FV P E+TA L ENNEE Sbjct: 185 AKRARNAASSVRDQVVPFVGPIPERTAGLKENNEE 219