BLASTX nr result
ID: Ophiopogon22_contig00020303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020303 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257911.1| pentatricopeptide repeat-containing protein ... 77 3e-14 ref|XP_008803620.1| PREDICTED: pentatricopeptide repeat-containi... 64 7e-09 ref|XP_010940322.1| PREDICTED: pentatricopeptide repeat-containi... 64 9e-09 ref|XP_020112944.1| pentatricopeptide repeat-containing protein ... 62 2e-08 gb|PKA65183.1| Pentatricopeptide repeat-containing protein [Apos... 62 3e-08 gb|OAY75201.1| Pentatricopeptide repeat-containing protein, mito... 62 3e-08 ref|XP_009401166.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_010935506.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_020590437.1| pentatricopeptide repeat-containing protein ... 57 3e-06 gb|PKU79412.1| Pentatricopeptide repeat-containing protein [Dend... 56 4e-06 ref|XP_020686427.1| pentatricopeptide repeat-containing protein ... 56 4e-06 ref|XP_020686426.1| pentatricopeptide repeat-containing protein ... 56 4e-06 ref|XP_020686425.1| pentatricopeptide repeat-containing protein ... 56 4e-06 >ref|XP_020257911.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Asparagus officinalis] ref|XP_020257912.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Asparagus officinalis] ref|XP_020257913.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Asparagus officinalis] gb|ONK76135.1| uncharacterized protein A4U43_C03F24310 [Asparagus officinalis] Length = 178 Score = 76.6 bits (187), Expect = 3e-14 Identities = 39/53 (73%), Positives = 44/53 (83%), Gaps = 1/53 (1%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDK-DGDEGEEQASAA 356 LVK +R+R AKRVVTGLRKKF KDFVGGWLELEK+VGLDK DG E +E+ A Sbjct: 126 LVKEKRVRAAKRVVTGLRKKFEKDFVGGWLELEKIVGLDKNDGGEEDEKVVEA 178 >ref|XP_008803620.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Phoenix dactylifera] Length = 386 Score = 64.3 bits (155), Expect = 7e-09 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQASAA 356 L+K ++R AKRVV+GL+KKF +DF G W +LEKVVG++ DG EG EQA AA Sbjct: 336 LMKNSKVRAAKRVVSGLKKKFPEDFTGDWKKLEKVVGVNVDG-EGSEQAVAA 386 >ref|XP_010940322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] Length = 388 Score = 63.9 bits (154), Expect = 9e-09 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQASAA 356 L+K ++R AKRVV+GL+KKF DF G W +LEKVVG+D DGD G EQA A Sbjct: 338 LMKKSKVRAAKRVVSGLKKKFPADFTGDWRKLEKVVGVDVDGD-GAEQAGVA 388 >ref|XP_020112944.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Ananas comosus] Length = 301 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQAS 362 L++ ++R AKR VTGLRKKF +DF G W LEKVVGL KDG G + A+ Sbjct: 244 LMRAGKVRAAKRAVTGLRKKFPEDFTGEWKSLEKVVGLSKDGGGGSDPAA 293 >gb|PKA65183.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 380 Score = 62.4 bits (150), Expect = 3e-08 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQASAA 356 L+KG R R AKRVVTGLRKKF K+FVG W LEK+VGL D +E QA A Sbjct: 330 LMKGSRKRDAKRVVTGLRKKFPKEFVGSWKRLEKMVGLSSD-EEAPLQAEVA 380 >gb|OAY75201.1| Pentatricopeptide repeat-containing protein, mitochondrial [Ananas comosus] Length = 387 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQAS 362 L++ ++R AKR VTGLRKKF +DF G W LEKVVGL KDG G + A+ Sbjct: 330 LMRAGKVRAAKRAVTGLRKKFPEDFTGEWKSLEKVVGLSKDGGGGSDPAA 379 >ref|XP_009401166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 382 Score = 58.5 bits (140), Expect = 7e-07 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQASAA 356 LVK ++R AKRVV GL+KKF +DFVG W +LEKVVGL D +EG + A Sbjct: 332 LVKASKLRDAKRVVGGLKKKFPEDFVGEWKKLEKVVGLSAD-EEGSDNTMTA 382 >ref|XP_010935506.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] Length = 386 Score = 58.5 bits (140), Expect = 7e-07 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKDGDEGEEQASAA 356 L+K ++R AKRV++GL+KKF K F G W +LEKVVG++ +G EG EQ AA Sbjct: 336 LMKNSKVRAAKRVISGLKKKFPKYFTGDWKKLEKVVGVNVNG-EGSEQVVAA 386 >ref|XP_020590437.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Phalaenopsis equestris] Length = 370 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKD 389 L+K ++R AKRVVTGLRKKF +DF G W +LE VVGL D Sbjct: 322 LMKASKIRAAKRVVTGLRKKFPEDFSGSWKKLENVVGLSND 362 >gb|PKU79412.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 373 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKD 389 L+K ++R AKRVVTGLRKKF ++F G W++LE VVGL D Sbjct: 325 LMKDSKIRAAKRVVTGLRKKFPEEFSGSWMKLENVVGLSND 365 >ref|XP_020686427.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X3 [Dendrobium catenatum] Length = 377 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKD 389 L+K ++R AKRVVTGLRKKF ++F G W++LE VVGL D Sbjct: 325 LMKDSKIRAAKRVVTGLRKKFPEEFSGSWMKLENVVGLSND 365 >ref|XP_020686426.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X2 [Dendrobium catenatum] Length = 403 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKD 389 L+K ++R AKRVVTGLRKKF ++F G W++LE VVGL D Sbjct: 325 LMKDSKIRAAKRVVTGLRKKFPEEFSGSWMKLENVVGLSND 365 >ref|XP_020686425.1| pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Dendrobium catenatum] Length = 409 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 511 LVKGERMRVAKRVVTGLRKKFSKDFVGGWLELEKVVGLDKD 389 L+K ++R AKRVVTGLRKKF ++F G W++LE VVGL D Sbjct: 325 LMKDSKIRAAKRVVTGLRKKFPEEFSGSWMKLENVVGLSND 365