BLASTX nr result
ID: Ophiopogon22_contig00020300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020300 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250809.1| uncharacterized protein LOC109828189 [Aspara... 64 3e-09 >ref|XP_020250809.1| uncharacterized protein LOC109828189 [Asparagus officinalis] gb|ONK80926.1| uncharacterized protein A4U43_C01F23320 [Asparagus officinalis] Length = 261 Score = 63.5 bits (153), Expect = 3e-09 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +3 Query: 201 KDYPRPSPAPRTPESSPAASIAVVERKPKEQHPSQFLSSNRARSDRGQ-PEKEEGQSRGL 377 K+ PRPS P+T ES PA S AV+E+KP+EQHP QFLSSNR RS+R + E+ G R L Sbjct: 37 KNSPRPSSTPQTLES-PAFSTAVIEKKPREQHPCQFLSSNRPRSERAKLDERYLGYERWL 95 Query: 378 VEDP 389 P Sbjct: 96 PVAP 99