BLASTX nr result
ID: Ophiopogon22_contig00020178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020178 (799 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264585.1| LOW QUALITY PROTEIN: protein CHLOROPLAST IMP... 74 2e-11 gb|ONK79432.1| uncharacterized protein A4U43_C01F6310 [Asparagus... 74 2e-11 ref|XP_020275343.1| protein CHLOROPLAST IMPORT APPARATUS 2-like ... 74 2e-11 >ref|XP_020264585.1| LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 2-like [Asparagus officinalis] Length = 381 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +3 Query: 21 VELKSGLGLKLNHEDVLRAWSDRDFPFSNESGTPESSADILVRI 152 VELKSGL LKLNHEDV++AWSDRDFP S ESG ESSAD+L R+ Sbjct: 269 VELKSGLXLKLNHEDVVKAWSDRDFPISTESGAAESSADVLARL 312 >gb|ONK79432.1| uncharacterized protein A4U43_C01F6310 [Asparagus officinalis] Length = 386 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/52 (75%), Positives = 45/52 (86%), Gaps = 3/52 (5%) Frame = +3 Query: 6 TC--SLDVELKS-GLGLKLNHEDVLRAWSDRDFPFSNESGTPESSADILVRI 152 TC SL+VELKS GLGLKLN EDVL+ WSDR+FPF++ESGTPESSADI R+ Sbjct: 294 TCNSSLEVELKSAGLGLKLNTEDVLKDWSDREFPFASESGTPESSADIHARL 345 >ref|XP_020275343.1| protein CHLOROPLAST IMPORT APPARATUS 2-like [Asparagus officinalis] ref|XP_020275350.1| protein CHLOROPLAST IMPORT APPARATUS 2-like [Asparagus officinalis] Length = 388 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/52 (75%), Positives = 45/52 (86%), Gaps = 3/52 (5%) Frame = +3 Query: 6 TC--SLDVELKS-GLGLKLNHEDVLRAWSDRDFPFSNESGTPESSADILVRI 152 TC SL+VELKS GLGLKLN EDVL+ WSDR+FPF++ESGTPESSADI R+ Sbjct: 294 TCNSSLEVELKSAGLGLKLNTEDVLKDWSDREFPFASESGTPESSADIHARL 345