BLASTX nr result
ID: Ophiopogon22_contig00019278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019278 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264805.1| premnaspirodiene oxygenase-like [Asparagus o... 54 9e-06 >ref|XP_020264805.1| premnaspirodiene oxygenase-like [Asparagus officinalis] gb|ONK69708.1| uncharacterized protein A4U43_C05F25900 [Asparagus officinalis] Length = 507 Score = 54.3 bits (129), Expect = 9e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 139 DIFARGSGA*ASAMT*TMSKLIQSPRVMKKAQDWVPRLTTDKFEI 5 DIFA GSG AS+MT TMS+LIQ+PRVMKKAQD V R+ K +I Sbjct: 302 DIFAGGSGTSASSMTWTMSELIQNPRVMKKAQDEVRRVVGSKPKI 346