BLASTX nr result
ID: Ophiopogon22_contig00019100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019100 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262741.1| uncharacterized protein LOC109838730 [Aspara... 59 2e-07 >ref|XP_020262741.1| uncharacterized protein LOC109838730 [Asparagus officinalis] ref|XP_020262742.1| uncharacterized protein LOC109838730 [Asparagus officinalis] gb|ONK73401.1| uncharacterized protein A4U43_C04F31100 [Asparagus officinalis] Length = 1098 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 416 ENAASVMATATVREGNKKSINVHPDYEFFLSRRQ 315 ENAASVMA A VR+GN+KS+N HPDYEFFLSRR+ Sbjct: 1065 ENAASVMARAAVRKGNQKSVNKHPDYEFFLSRRR 1098