BLASTX nr result
ID: Ophiopogon22_contig00018964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00018964 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017698871.1| PREDICTED: biotin carboxyl carrier protein o... 100 9e-24 ref|XP_018684587.1| PREDICTED: biotin carboxyl carrier protein o... 101 2e-23 gb|AGT55821.1| biotin carboxyl carrier protein [Cocos nucifera] 100 3e-23 ref|XP_008805111.1| PREDICTED: biotin carboxyl carrier protein o... 100 3e-23 ref|XP_008805110.1| PREDICTED: biotin carboxyl carrier protein o... 100 4e-23 ref|XP_008805109.1| PREDICTED: biotin carboxyl carrier protein o... 100 5e-23 emb|CBI22298.3| unnamed protein product, partial [Vitis vinifera] 94 6e-23 ref|XP_010936329.1| PREDICTED: biotin carboxyl carrier protein o... 100 7e-23 ref|XP_020104517.1| biotin carboxyl carrier protein of acetyl-Co... 100 7e-23 ref|XP_010936328.1| PREDICTED: biotin carboxyl carrier protein o... 100 8e-23 ref|XP_021768818.1| biotin carboxyl carrier protein of acetyl-Co... 99 1e-22 ref|XP_021285969.1| biotin carboxyl carrier protein of acetyl-Co... 98 2e-22 ref|XP_019080687.1| PREDICTED: biotin carboxyl carrier protein o... 94 2e-22 ref|XP_017972564.1| PREDICTED: biotin carboxyl carrier protein o... 98 3e-22 ref|XP_020082975.1| biotin carboxyl carrier protein of acetyl-Co... 98 4e-22 ref|XP_010939150.1| PREDICTED: biotin carboxyl carrier protein o... 98 4e-22 ref|XP_009394324.1| PREDICTED: biotin carboxyl carrier protein o... 98 4e-22 emb|CAA62262.1| biotin carboxyl carrier protein, partial (macron... 92 5e-22 ref|XP_010939149.1| PREDICTED: biotin carboxyl carrier protein o... 98 5e-22 ref|XP_020275291.1| biotin carboxyl carrier protein of acetyl-Co... 97 5e-22 >ref|XP_017698871.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Phoenix dactylifera] Length = 206 Score = 100 bits (249), Expect = 9e-24 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+DTPLL+IQP Sbjct: 156 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSIDTPLLIIQP 206 >ref|XP_018684587.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Musa acuminata subsp. malaccensis] ref|XP_018684588.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 286 Score = 101 bits (251), Expect = 2e-23 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP Sbjct: 236 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 286 >gb|AGT55821.1| biotin carboxyl carrier protein [Cocos nucifera] Length = 285 Score = 100 bits (250), Expect = 3e-23 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLL+IQP Sbjct: 235 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLIIQP 285 >ref|XP_008805111.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X3 [Phoenix dactylifera] Length = 270 Score = 100 bits (249), Expect = 3e-23 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+DTPLL+IQP Sbjct: 220 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSIDTPLLIIQP 270 >ref|XP_008805110.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X2 [Phoenix dactylifera] Length = 275 Score = 100 bits (249), Expect = 4e-23 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+DTPLL+IQP Sbjct: 225 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSIDTPLLIIQP 275 >ref|XP_008805109.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X1 [Phoenix dactylifera] Length = 286 Score = 100 bits (249), Expect = 5e-23 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+DTPLL+IQP Sbjct: 236 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSIDTPLLIIQP 286 >emb|CBI22298.3| unnamed protein product, partial [Vitis vinifera] Length = 71 Score = 94.4 bits (233), Expect = 6e-23 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGT+ EILAEDGKPVS+D PLLVI P Sbjct: 21 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVSIDRPLLVIAP 71 >ref|XP_010936329.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Elaeis guineensis] Length = 270 Score = 99.8 bits (247), Expect = 7e-23 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVV+ILAEDGKPVSVDTPLL+IQP Sbjct: 220 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVDILAEDGKPVSVDTPLLIIQP 270 >ref|XP_020104517.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X1 [Ananas comosus] Length = 275 Score = 99.8 bits (247), Expect = 7e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGT+VEILAEDGKPVSVDTPL++IQP Sbjct: 225 DKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLMIIQP 275 >ref|XP_010936328.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Elaeis guineensis] Length = 281 Score = 99.8 bits (247), Expect = 8e-23 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVV+ILAEDGKPVSVDTPLL+IQP Sbjct: 231 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVDILAEDGKPVSVDTPLLIIQP 281 >ref|XP_021768818.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Chenopodium quinoa] Length = 273 Score = 99.4 bits (246), Expect = 1e-22 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQ++CIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+DTPLLVIQP Sbjct: 223 DKVQKGQIICIIEAMKLMNEIEADQSGTVVEILAEDGKPVSLDTPLLVIQP 273 >ref|XP_021285969.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Herrania umbratica] Length = 257 Score = 98.2 bits (243), Expect = 2e-22 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGT+VEILAEDGKPVSVDTPL VI+P Sbjct: 207 DKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFVIEP 257 >ref|XP_019080687.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X1 [Vitis vinifera] Length = 119 Score = 94.4 bits (233), Expect = 2e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGT+ EILAEDGKPVS+D PLLVI P Sbjct: 69 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVSIDRPLLVIAP 119 >ref|XP_017972564.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Theobroma cacao] Length = 279 Score = 98.2 bits (243), Expect = 3e-22 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGT+VEILAEDGKPVSVDTPL VI+P Sbjct: 229 DKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFVIEP 279 >ref|XP_020082975.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Ananas comosus] gb|OAY72770.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Ananas comosus] Length = 287 Score = 98.2 bits (243), Expect = 4e-22 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVS+D PLL+IQP Sbjct: 237 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSIDMPLLIIQP 287 >ref|XP_010939150.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Elaeis guineensis] Length = 270 Score = 97.8 bits (242), Expect = 4e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGK VSVDTPLL+IQP Sbjct: 220 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKAVSVDTPLLIIQP 270 >ref|XP_009394324.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Musa acuminata subsp. malaccensis] Length = 275 Score = 97.8 bits (242), Expect = 4e-22 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIE+DQSGTVVEI+AEDGKPVSVD+PLLVIQP Sbjct: 225 DKVQKGQVVCIIEAMKLMNEIESDQSGTVVEIIAEDGKPVSVDSPLLVIQP 275 >emb|CAA62262.1| biotin carboxyl carrier protein, partial (macronuclear) [Brassica napus] prf||2210244B Ac-CoA carboxylase:ISOTYPE=bp2 Length = 68 Score = 92.0 bits (227), Expect = 5e-22 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQV+CI+EAMKLMNEIE+DQ+GTVV+I+AEDGKPVS+DTPL V+QP Sbjct: 18 DKVQKGQVLCIVEAMKLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP 68 >ref|XP_010939149.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Elaeis guineensis] Length = 285 Score = 97.8 bits (242), Expect = 5e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGK VSVDTPLL+IQP Sbjct: 235 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKAVSVDTPLLIIQP 285 >ref|XP_020275291.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Asparagus officinalis] gb|ONK64721.1| uncharacterized protein A4U43_C07F29180 [Asparagus officinalis] Length = 272 Score = 97.4 bits (241), Expect = 5e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -3 Query: 395 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGKPVSVDTPLLVIQP 243 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDG+PVSVD PLLVIQP Sbjct: 222 DKVQKGQVVCIIEAMKLMNEIEADQSGTVVEILAEDGEPVSVDMPLLVIQP 272