BLASTX nr result
ID: Ophiopogon22_contig00018916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00018916 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK66510.1| uncharacterized protein A4U43_C06F8940 [Asparagus... 57 7e-07 >gb|ONK66510.1| uncharacterized protein A4U43_C06F8940 [Asparagus officinalis] Length = 288 Score = 57.0 bits (136), Expect = 7e-07 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +3 Query: 9 NDERKGEENKDEIRELRPSQSMRFVQNGMMVRHQPNNIEQATHVSPGLPPSPS-KSFRHK 185 N+ + G+E KDE+RE+RPSQ M SPGLPP P +S K Sbjct: 231 NELKLGDEEKDELREMRPSQDMG---------------------SPGLPPPPPPRSLGQK 269 Query: 186 FFRVVRKTTSAKEPKVSSF 242 FFRV++K+ ++PK+SS+ Sbjct: 270 FFRVIKKSMRTEQPKISSY 288