BLASTX nr result
ID: Ophiopogon22_contig00018771
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00018771 (1272 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO56868.1| chlorophyll b reductase, partial [Egeria densa] 56 8e-06 >dbj|BAO56868.1| chlorophyll b reductase, partial [Egeria densa] Length = 155 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 216 IYFFGEKGRRQLQASLLKECKRSKVGIHTASPGMV 112 +Y + G RQLQASLLKECKRSKVG+HTASPGMV Sbjct: 18 VYGSTKCGLRQLQASLLKECKRSKVGVHTASPGMV 52