BLASTX nr result
ID: Ophiopogon22_contig00018584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00018584 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791205.1| PREDICTED: O-glucosyltransferase rumi homolo... 59 3e-07 ref|XP_010923276.1| PREDICTED: O-glucosyltransferase rumi homolo... 58 1e-06 ref|XP_010923267.1| PREDICTED: O-glucosyltransferase rumi isofor... 58 1e-06 >ref|XP_008791205.1| PREDICTED: O-glucosyltransferase rumi homolog [Phoenix dactylifera] Length = 535 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +2 Query: 200 VGAAVFALFSLNTAVENLGSRARTVIGHNLEPTPWHTFEPAPHPHSPATIFRCSYL 367 V + + LF L AV+++ +R RTV GHNLEPTPWH F +T+ RCSYL Sbjct: 80 VSSVLVILFFLQRAVDDVFARTRTVAGHNLEPTPWHPFPHNKERPDASTVLRCSYL 135 >ref|XP_010923276.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Elaeis guineensis] Length = 454 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +2 Query: 221 LFSLNTAVENLGSRARTVIGHNLEPTPWHTFEPAPHPHSPATIFRCSYL 367 LF L AV+++ +R RTV GHNLEPTPWH F + +T+ RCSYL Sbjct: 94 LFFLQRAVDDVVARTRTVAGHNLEPTPWHPFPHSKVRPDASTVLRCSYL 142 >ref|XP_010923267.1| PREDICTED: O-glucosyltransferase rumi isoform X1 [Elaeis guineensis] Length = 542 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +2 Query: 221 LFSLNTAVENLGSRARTVIGHNLEPTPWHTFEPAPHPHSPATIFRCSYL 367 LF L AV+++ +R RTV GHNLEPTPWH F + +T+ RCSYL Sbjct: 94 LFFLQRAVDDVVARTRTVAGHNLEPTPWHPFPHSKVRPDASTVLRCSYL 142