BLASTX nr result
ID: Ophiopogon22_contig00018425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00018425 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245954.1| mediator-associated protein 2 [Asparagus off... 92 2e-19 >ref|XP_020245954.1| mediator-associated protein 2 [Asparagus officinalis] gb|ONK58635.1| uncharacterized protein A4U43_C09F15080 [Asparagus officinalis] Length = 219 Score = 91.7 bits (226), Expect = 2e-19 Identities = 51/89 (57%), Positives = 64/89 (71%) Frame = -2 Query: 555 GSERSSSHRSTVLRGTNGTSRDTFAFGHSTDMETPKPSNSKKKKYDDHRSAEGSPRGFRP 376 GS RSSSHRSTVL+G+ GT+ DTF F HST+ ETP+PS +KK+ ++HRS +GS RG RP Sbjct: 134 GSGRSSSHRSTVLKGSKGTA-DTFNFPHSTE-ETPQPS--RKKRREEHRSGDGSSRGSRP 189 Query: 375 DSQVTDTFVVSERSHGDXXXXXXXKTADE 289 DS +TD + S+RSHGD K DE Sbjct: 190 DSHLTDGSLASDRSHGDQSKKKNKKIKDE 218