BLASTX nr result
ID: Ophiopogon22_contig00017395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017395 (760 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONM27078.1| Beta-carotene isomerase D27 chloroplastic [Zea ma... 61 3e-08 ref|XP_003577412.1| PREDICTED: beta-carotene isomerase D27, chlo... 63 7e-08 gb|ONM27091.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 7e-08 gb|ONM27079.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 9e-08 gb|ABA94460.1| hypothetical protein LOC_Os11g37650 [Oryza sativa... 61 2e-07 gb|ONM27094.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 2e-07 gb|ONM27080.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 2e-07 gb|ONM27093.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 2e-07 ref|XP_008670838.1| beta-carotene isomerase D27, chloroplastic [... 61 2e-07 ref|NP_001144840.1| uncharacterized LOC100277925 precursor [Zea ... 61 2e-07 gb|ONM27081.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 2e-07 gb|EEC68482.1| hypothetical protein OsI_36734 [Oryza sativa Indi... 61 2e-07 gb|ONM27095.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] 61 2e-07 dbj|BAJ90178.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 2e-07 gb|OEL19947.1| Beta-carotene isomerase D27, chloroplastic [Dicha... 61 2e-07 ref|XP_015698117.1| PREDICTED: beta-carotene isomerase D27, chlo... 61 2e-07 gb|APW29131.1| chloroplast beta-carotene isomerase [Triticum aes... 61 2e-07 ref|XP_015615253.1| PREDICTED: beta-carotene isomerase D27, chlo... 61 2e-07 gb|PAN43190.1| hypothetical protein PAHAL_H00534 [Panicum hallii] 61 2e-07 ref|XP_020183166.1| beta-carotene isomerase D27, chloroplastic [... 61 2e-07 >gb|ONM27078.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] gb|ONM27096.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 134 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 87 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 122 >ref|XP_003577412.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Brachypodium distachyon] gb|KQJ88024.1| hypothetical protein BRADI_4g14990v3 [Brachypodium distachyon] Length = 277 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NFDDMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 232 VYMSPNFDDMSCEMIFGQQPPEDDPALKQPCFRTKC 267 >gb|ONM27091.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 176 Score = 61.2 bits (147), Expect = 7e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 129 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 164 >gb|ONM27079.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 190 Score = 61.2 bits (147), Expect = 9e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 143 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 178 >gb|ABA94460.1| hypothetical protein LOC_Os11g37650 [Oryza sativa Japonica Group] gb|EAZ18968.1| hypothetical protein OsJ_34503 [Oryza sativa Japonica Group] Length = 236 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 189 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 224 >gb|ONM27094.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 246 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 199 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 234 >gb|ONM27080.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 257 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 210 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 245 >gb|ONM27093.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 259 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 212 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 247 >ref|XP_008670838.1| beta-carotene isomerase D27, chloroplastic [Zea mays] Length = 260 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 213 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 248 >ref|NP_001144840.1| uncharacterized LOC100277925 precursor [Zea mays] gb|ACG43331.1| hypothetical protein [Zea mays] Length = 262 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 215 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 250 >gb|ONM27081.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 273 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 226 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 261 >gb|EEC68482.1| hypothetical protein OsI_36734 [Oryza sativa Indica Group] Length = 274 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 227 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 262 >gb|ONM27095.1| Beta-carotene isomerase D27 chloroplastic [Zea mays] Length = 275 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 228 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 263 >dbj|BAJ90178.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 275 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 230 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFSTKC 265 >gb|OEL19947.1| Beta-carotene isomerase D27, chloroplastic [Dichanthelium oligosanthes] Length = 276 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 229 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 264 >ref|XP_015698117.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Oryza brachyantha] Length = 277 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPA KQP L +C Sbjct: 230 VYMSPNFEDMSCEMIFGQQPPEDDPAFKQPCLRTKC 265 >gb|APW29131.1| chloroplast beta-carotene isomerase [Triticum aestivum] Length = 278 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 233 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFSTKC 268 >ref|XP_015615253.1| PREDICTED: beta-carotene isomerase D27, chloroplastic [Oryza sativa Japonica Group] sp|C7AU21.1|D27_ORYSJ RecName: Full=Beta-carotene isomerase D27, chloroplastic; AltName: Full=Protein DWARF-27; Flags: Precursor gb|ACT91266.1| DWARF27 [Oryza sativa Japonica Group] dbj|BAT14645.1| Os11g0587000 [Oryza sativa Japonica Group] Length = 278 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 231 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 266 >gb|PAN43190.1| hypothetical protein PAHAL_H00534 [Panicum hallii] Length = 279 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 232 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFRTKC 267 >ref|XP_020183166.1| beta-carotene isomerase D27, chloroplastic [Aegilops tauschii subsp. tauschii] Length = 280 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 324 IVMASNFDDMSCEMIFGQEPPEDDPALKQPSLWCRC 431 + M+ NF+DMSCEMIFGQ+PPEDDPALKQP +C Sbjct: 235 VYMSPNFEDMSCEMIFGQQPPEDDPALKQPCFSTKC 270