BLASTX nr result
ID: Ophiopogon22_contig00017014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017014 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80163.1| uncharacterized protein A4U43_C01F14560 [Asparagu... 59 3e-08 ref|XP_020245160.1| RNA demethylase ALKBH5 [Asparagus officinalis] 59 1e-07 >gb|ONK80163.1| uncharacterized protein A4U43_C01F14560 [Asparagus officinalis] Length = 164 Score = 58.9 bits (141), Expect = 3e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -1 Query: 284 EEPSRSGGGRRVRLDQKRLVISRNIDGDEEVSSRSFDQARNSRGIRPLPNTG 129 EEP+ SG +R+ LDQ+R V+SRN +GD E+SS SFD NSRGI PNTG Sbjct: 105 EEPNESG--QRLSLDQRRFVVSRNFEGDAEISSHSFD---NSRGILQTPNTG 151 >ref|XP_020245160.1| RNA demethylase ALKBH5 [Asparagus officinalis] Length = 548 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -1 Query: 284 EEPSRSGGGRRVRLDQKRLVISRNIDGDEEVSSRSFDQARNSRGIRPLPNTG 129 EEP+ SG +R+ LDQ+R V+SRN +GD E+SS SFD NSRGI PNTG Sbjct: 489 EEPNESG--QRLSLDQRRFVVSRNFEGDAEISSHSFD---NSRGILQTPNTG 535