BLASTX nr result
ID: Ophiopogon22_contig00016454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016454 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273390.1| suppressor protein SRP40 [Asparagus officina... 83 1e-15 >ref|XP_020273390.1| suppressor protein SRP40 [Asparagus officinalis] Length = 476 Score = 83.2 bits (204), Expect = 1e-15 Identities = 52/104 (50%), Positives = 61/104 (58%) Frame = -3 Query: 312 QAPKTLATSALIPFVPRQVMLDSKSSFAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 133 +APK ATSALIPFVPRQVMLDSKSS +ID Sbjct: 3 RAPKPPATSALIPFVPRQVMLDSKSSTSIDSKLKNKEMEKENKKKKKESRGRASE----- 57 Query: 132 TLENGSVDPKTLTVDDAGAKGKSRQMLLSSIAAFLENNGFHKTL 1 TLENGS P+TL VD G + K R++LLSSIA FLE++GF +TL Sbjct: 58 TLENGSGAPETLEVDGDGGRRKDRKLLLSSIAGFLESSGFLRTL 101