BLASTX nr result
ID: Ophiopogon22_contig00016373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016373 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274934.1| protein LIKE COV 1-like [Asparagus officinal... 72 2e-13 ref|XP_022730980.1| protein CONTINUOUS VASCULAR RING 1-like isof... 70 4e-12 ref|XP_022841880.1| uncharacterized protein LOC111365554 [Olea e... 69 4e-12 ref|XP_022730979.1| protein CONTINUOUS VASCULAR RING 1-like isof... 70 7e-12 ref|XP_008792337.1| PREDICTED: protein CONTINUOUS VASCULAR RING ... 68 4e-11 gb|OVA20343.1| Protein of unknown function DUF502 [Macleaya cord... 68 5e-11 gb|PKU83791.1| hypothetical protein MA16_Dca010884 [Dendrobium c... 67 5e-11 gb|AQK94996.1| Protein LIKE COV 1 [Zea mays] 65 6e-11 gb|KJB64921.1| hypothetical protein B456_010G072300 [Gossypium r... 65 8e-11 ref|XP_010493921.1| PREDICTED: protein CONTINUOUS VASCULAR RING ... 66 8e-11 gb|KJB83128.1| hypothetical protein B456_013G230800 [Gossypium r... 66 8e-11 ref|XP_020098878.1| protein LIKE COV 1-like [Ananas comosus] >gi... 67 1e-10 ref|XP_020694298.1| protein LIKE COV 1-like isoform X2 [Dendrobi... 67 1e-10 gb|ABR25803.1| cov1, partial [Oryza sativa Indica Group] 62 1e-10 ref|XP_020694297.1| protein LIKE COV 1-like isoform X1 [Dendrobi... 67 1e-10 ref|XP_006408926.1| protein CONTINUOUS VASCULAR RING 1 [Eutrema ... 67 1e-10 gb|PPR87634.1| hypothetical protein GOBAR_AA33057 [Gossypium bar... 66 1e-10 ref|XP_016673745.1| PREDICTED: protein CONTINUOUS VASCULAR RING ... 66 2e-10 ref|XP_016719431.1| PREDICTED: protein CONTINUOUS VASCULAR RING ... 66 2e-10 ref|XP_012465298.1| PREDICTED: protein CONTINUOUS VASCULAR RING ... 66 2e-10 >ref|XP_020274934.1| protein LIKE COV 1-like [Asparagus officinalis] gb|ONK62512.1| uncharacterized protein A4U43_C07F4700 [Asparagus officinalis] Length = 145 Score = 71.6 bits (174), Expect = 2e-13 Identities = 38/48 (79%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLE-PTLQSRNRSIRS 222 INS+DVIRPNLSVREGIEIVVSVGMSMPQVLST + T+Q+R RS+R+ Sbjct: 98 INSKDVIRPNLSVREGIEIVVSVGMSMPQVLSTQDSTTMQNRTRSMRN 145 >ref|XP_022730980.1| protein CONTINUOUS VASCULAR RING 1-like isoform X2 [Durio zibethinus] Length = 216 Score = 70.1 bits (170), Expect = 4e-12 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+ LQ +RS RS Sbjct: 170 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDTRLQMESRSDRS 216 >ref|XP_022841880.1| uncharacterized protein LOC111365554 [Olea europaea var. sylvestris] Length = 166 Score = 68.9 bits (167), Expect = 4e-12 Identities = 38/49 (77%), Positives = 43/49 (87%), Gaps = 2/49 (4%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEP-TLQ-SRNRSIRS 222 +N+ DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+P T+Q RNRS RS Sbjct: 118 VNANDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPRTIQVDRNRSNRS 166 >ref|XP_022730979.1| protein CONTINUOUS VASCULAR RING 1-like isoform X1 [Durio zibethinus] Length = 265 Score = 70.1 bits (170), Expect = 7e-12 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+ LQ +RS RS Sbjct: 219 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDTRLQMESRSDRS 265 >ref|XP_008792337.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Phoenix dactylifera] ref|XP_008792338.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Phoenix dactylifera] Length = 267 Score = 68.2 bits (165), Expect = 4e-11 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 +NS+DVIRPNLSVREGIEIVVSVGMSMPQ+L+TL+P +R+I S Sbjct: 219 VNSRDVIRPNLSVREGIEIVVSVGMSMPQILATLDPHTIHVDRTIAS 265 >gb|OVA20343.1| Protein of unknown function DUF502 [Macleaya cordata] Length = 264 Score = 67.8 bits (164), Expect = 5e-11 Identities = 36/48 (75%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEP-TLQSRNRSIRS 222 +N +DVIRPNLSVREGIEIVVS GMSMPQ+LSTLE T+Q R+RS R+ Sbjct: 217 VNCKDVIRPNLSVREGIEIVVSGGMSMPQILSTLETHTIQDRSRSGRN 264 >gb|PKU83791.1| hypothetical protein MA16_Dca010884 [Dendrobium catenatum] Length = 191 Score = 66.6 bits (161), Expect = 5e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSR 240 +NS+DVIRPNLSVREGIEIVVS GMSMPQ+LSTLEP R Sbjct: 150 VNSRDVIRPNLSVREGIEIVVSGGMSMPQILSTLEPQTSLR 190 >gb|AQK94996.1| Protein LIKE COV 1 [Zea mays] Length = 146 Score = 65.5 bits (158), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTL 249 +NS+DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+P + Sbjct: 98 VNSKDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPEM 135 >gb|KJB64921.1| hypothetical protein B456_010G072300 [Gossypium raimondii] Length = 145 Score = 65.1 bits (157), Expect = 8e-11 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQ-SRNRSIRS 222 IN+ DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+ L R+RS RS Sbjct: 98 INTNDVIRPNLSVREGIEIVVSGGMSMPQILSTLDSRLPLERSRSNRS 145 >ref|XP_010493921.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Camelina sativa] Length = 201 Score = 66.2 bits (160), Expect = 8e-11 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 3/47 (6%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLE---PTLQSRNRS 231 +N++DVIRPNLSVREGIEIVVS GMSMPQVLSTL+ PT +SR+R+ Sbjct: 155 VNTKDVIRPNLSVREGIEIVVSGGMSMPQVLSTLDMRTPTERSRSRN 201 >gb|KJB83128.1| hypothetical protein B456_013G230800 [Gossypium raimondii] Length = 202 Score = 66.2 bits (160), Expect = 8e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LST++ L +RS RS Sbjct: 156 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDTRLPLESRSDRS 202 >ref|XP_020098878.1| protein LIKE COV 1-like [Ananas comosus] gb|OAY78750.1| Protein CONTINUOUS VASCULAR RING 1 [Ananas comosus] Length = 273 Score = 67.0 bits (162), Expect = 1e-10 Identities = 36/49 (73%), Positives = 43/49 (87%), Gaps = 2/49 (4%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEP--TLQSRNRSIRS 222 +NS+DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+P L++R R+ RS Sbjct: 225 VNSRDVIRPNLSVREGIEIVVSGGMSMPQLLSTLDPHTILENRARAGRS 273 >ref|XP_020694298.1| protein LIKE COV 1-like isoform X2 [Dendrobium catenatum] Length = 260 Score = 66.6 bits (161), Expect = 1e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSR 240 +NS+DVIRPNLSVREGIEIVVS GMSMPQ+LSTLEP R Sbjct: 219 VNSRDVIRPNLSVREGIEIVVSGGMSMPQILSTLEPQTSLR 259 >gb|ABR25803.1| cov1, partial [Oryza sativa Indica Group] Length = 61 Score = 62.4 bits (150), Expect = 1e-10 Identities = 36/49 (73%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQ--SRNRSIRS 222 +NS DVIRPNLSVREGIEIVVS GMSMPQVLS +E SR RS RS Sbjct: 13 VNSSDVIRPNLSVREGIEIVVSGGMSMPQVLSIVETEQNQWSRMRSSRS 61 >ref|XP_020694297.1| protein LIKE COV 1-like isoform X1 [Dendrobium catenatum] Length = 261 Score = 66.6 bits (161), Expect = 1e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSR 240 +NS+DVIRPNLSVREGIEIVVS GMSMPQ+LSTLEP R Sbjct: 220 VNSRDVIRPNLSVREGIEIVVSGGMSMPQILSTLEPQTSLR 260 >ref|XP_006408926.1| protein CONTINUOUS VASCULAR RING 1 [Eutrema salsugineum] gb|ESQ50379.1| hypothetical protein EUTSA_v10002075mg [Eutrema salsugineum] Length = 266 Score = 66.6 bits (161), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRS 231 +NS DVIRPNLSVREGIEIVVS GMSMPQ+LSTL+ L S +RS Sbjct: 220 VNSNDVIRPNLSVREGIEIVVSGGMSMPQILSTLDKPLASIDRS 263 >gb|PPR87634.1| hypothetical protein GOBAR_AA33057 [Gossypium barbadense] Length = 237 Score = 66.2 bits (160), Expect = 1e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LST++ L +RS RS Sbjct: 191 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDTRLPLESRSDRS 237 >ref|XP_016673745.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Gossypium hirsutum] Length = 262 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LST++ L +RS RS Sbjct: 216 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDTRLPLESRSDRS 262 >ref|XP_016719431.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Gossypium hirsutum] ref|XP_016719432.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Gossypium hirsutum] ref|XP_016719433.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Gossypium hirsutum] Length = 262 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LST++ L +RS RS Sbjct: 216 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDTRLPLESRSDRS 262 >ref|XP_012465298.1| PREDICTED: protein CONTINUOUS VASCULAR RING 1-like [Gossypium raimondii] gb|KJB83126.1| hypothetical protein B456_013G230800 [Gossypium raimondii] Length = 262 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 362 INSQDVIRPNLSVREGIEIVVSVGMSMPQVLSTLEPTLQSRNRSIRS 222 IN++DVIRPNLSVREGIEIVVS GMSMPQ+LST++ L +RS RS Sbjct: 216 INTKDVIRPNLSVREGIEIVVSGGMSMPQILSTVDTRLPLESRSDRS 262