BLASTX nr result
ID: Ophiopogon22_contig00016156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016156 (864 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008809436.1| PREDICTED: la-related protein 1C-like [Phoen... 68 5e-09 gb|OMO75488.1| hypothetical protein COLO4_26105 [Corchorus olito... 66 9e-09 ref|XP_010933359.1| PREDICTED: la-related protein 1C-like [Elaei... 66 2e-08 ref|XP_007204320.1| la-related protein 1C [Prunus persica] >gi|1... 65 3e-08 ref|XP_021656438.1| la-related protein 1C-like [Hevea brasiliens... 65 3e-08 ref|XP_021649855.1| la-related protein 1C-like isoform X4 [Hevea... 65 4e-08 ref|XP_009363455.1| PREDICTED: la-related protein 1C-like [Pyrus... 65 4e-08 ref|XP_021601539.1| la-related protein 1C-like isoform X2 [Manih... 65 4e-08 ref|XP_021649854.1| la-related protein 1C-like isoform X3 [Hevea... 65 4e-08 ref|XP_008337981.1| PREDICTED: la-related protein 1C [Malus dome... 65 4e-08 ref|XP_021601532.1| la-related protein 1C-like isoform X1 [Manih... 65 4e-08 ref|XP_021815356.1| la-related protein 1C-like [Prunus avium] 65 4e-08 ref|XP_008242034.1| PREDICTED: la-related protein 1C [Prunus mume] 65 4e-08 ref|XP_021649853.1| la-related protein 1C-like isoform X2 [Hevea... 65 4e-08 ref|XP_021649852.1| la-related protein 1C-like isoform X1 [Hevea... 65 4e-08 gb|EEF31226.1| lupus la ribonucleoprotein, putative [Ricinus com... 65 5e-08 ref|XP_015582075.1| PREDICTED: la-related protein 1C [Ricinus co... 65 5e-08 ref|XP_009414439.1| PREDICTED: la-related protein 1B-like isofor... 64 9e-08 ref|XP_009414437.1| PREDICTED: la-related protein 1B-like isofor... 64 1e-07 gb|OMO87344.1| RNA-binding protein Lupus La [Corchorus capsularis] 64 1e-07 >ref|XP_008809436.1| PREDICTED: la-related protein 1C-like [Phoenix dactylifera] Length = 585 Score = 67.8 bits (164), Expect = 5e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 251 SSSIEANVAAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSES 382 SSS ++ AA ARG++P W PSNG+IEVGPVMGAVSWP LSES Sbjct: 105 SSSSSSSAAAAARGKKPAWQRPSNGSIEVGPVMGAVSWPPLSES 148 >gb|OMO75488.1| hypothetical protein COLO4_26105 [Corchorus olitorius] Length = 277 Score = 65.9 bits (159), Expect = 9e-09 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +2 Query: 245 ADSSSIEANVAAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 AD S +N A AR ++P WN PSNG +EV PVMGA SWPALSESA Sbjct: 94 ADGGSDSSNNNAAARSKKPAWNKPSNGVVEVSPVMGAASWPALSESA 140 >ref|XP_010933359.1| PREDICTED: la-related protein 1C-like [Elaeis guineensis] Length = 500 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 245 ADSSSIEANVAAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSES 382 A S S ++ AA ARG++P W PSNG+IEVGPVMGAVSWP LSES Sbjct: 17 AASISSSSSAAAAARGKKPAWQRPSNGSIEVGPVMGAVSWPPLSES 62 >ref|XP_007204320.1| la-related protein 1C [Prunus persica] gb|ONH97166.1| hypothetical protein PRUPE_7G173400 [Prunus persica] Length = 544 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RP WN PSNGAIEVGPVMGAVSWPALSESA Sbjct: 123 GKRPAWNKPSNGAIEVGPVMGAVSWPALSESA 154 >ref|XP_021656438.1| la-related protein 1C-like [Hevea brasiliensis] ref|XP_021656439.1| la-related protein 1C-like [Hevea brasiliensis] Length = 551 Score = 65.5 bits (158), Expect = 3e-08 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +2 Query: 242 TADSSSIE-ANVAAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 TA+ ++ NV+ +RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 97 TAEEEILDNGNVSNSNAAKRPVWNKPSNGATEVGPVMGAVSWPALSESA 145 >ref|XP_021649855.1| la-related protein 1C-like isoform X4 [Hevea brasiliensis] Length = 481 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 37 GKRPVWNKPSNGAAEVGPVMGAVSWPALSESA 68 >ref|XP_009363455.1| PREDICTED: la-related protein 1C-like [Pyrus x bretschneideri] Length = 531 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RP WN PSNGA+EVGPVMGAVSWPALSESA Sbjct: 122 GKRPAWNKPSNGAVEVGPVMGAVSWPALSESA 153 >ref|XP_021601539.1| la-related protein 1C-like isoform X2 [Manihot esculenta] Length = 533 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 114 GKRPVWNKPSNGATEVGPVMGAVSWPALSESA 145 >ref|XP_021649854.1| la-related protein 1C-like isoform X3 [Hevea brasiliensis] Length = 538 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 114 GKRPVWNKPSNGAAEVGPVMGAVSWPALSESA 145 >ref|XP_008337981.1| PREDICTED: la-related protein 1C [Malus domestica] Length = 541 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RP WN PSNGA+EVGPVMGAVSWPALSESA Sbjct: 122 GKRPAWNKPSNGAVEVGPVMGAVSWPALSESA 153 >ref|XP_021601532.1| la-related protein 1C-like isoform X1 [Manihot esculenta] gb|OAY57592.1| hypothetical protein MANES_02G109100 [Manihot esculenta] Length = 543 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 114 GKRPVWNKPSNGATEVGPVMGAVSWPALSESA 145 >ref|XP_021815356.1| la-related protein 1C-like [Prunus avium] Length = 544 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RP WN PSNGA+EVGPVMGAVSWPALSESA Sbjct: 123 GKRPAWNKPSNGAVEVGPVMGAVSWPALSESA 154 >ref|XP_008242034.1| PREDICTED: la-related protein 1C [Prunus mume] Length = 544 Score = 65.1 bits (157), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RP WN PSNGA+EVGPVMGAVSWPALSESA Sbjct: 123 GKRPAWNKPSNGAVEVGPVMGAVSWPALSESA 154 >ref|XP_021649853.1| la-related protein 1C-like isoform X2 [Hevea brasiliensis] Length = 548 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 114 GKRPVWNKPSNGAAEVGPVMGAVSWPALSESA 145 >ref|XP_021649852.1| la-related protein 1C-like isoform X1 [Hevea brasiliensis] Length = 558 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 G+RPVWN PSNGA EVGPVMGAVSWPALSESA Sbjct: 114 GKRPVWNKPSNGAAEVGPVMGAVSWPALSESA 145 >gb|EEF31226.1| lupus la ribonucleoprotein, putative [Ricinus communis] Length = 471 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESATV 391 G+RPVWN PSNGA+EVG VMGAVSWPALSESA V Sbjct: 104 GKRPVWNKPSNGAVEVGAVMGAVSWPALSESARV 137 >ref|XP_015582075.1| PREDICTED: la-related protein 1C [Ricinus communis] Length = 474 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 290 GRRPVWNVPSNGAIEVGPVMGAVSWPALSESATV 391 G+RPVWN PSNGA+EVG VMGAVSWPALSESA V Sbjct: 104 GKRPVWNKPSNGAVEVGAVMGAVSWPALSESARV 137 >ref|XP_009414439.1| PREDICTED: la-related protein 1B-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 499 Score = 63.9 bits (154), Expect = 9e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 275 AAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSESAT 388 AA RG+RP WNVP+NGAIEVGPVMGA SWPALS S + Sbjct: 66 AAGDRGKRPAWNVPANGAIEVGPVMGADSWPALSASGS 103 >ref|XP_009414437.1| PREDICTED: la-related protein 1B-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 529 Score = 63.9 bits (154), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 275 AAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSESAT 388 AA RG+RP WNVP+NGAIEVGPVMGA SWPALS S + Sbjct: 66 AAGDRGKRPAWNVPANGAIEVGPVMGADSWPALSASGS 103 >gb|OMO87344.1| RNA-binding protein Lupus La [Corchorus capsularis] Length = 508 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 269 NVAAEARGRRPVWNVPSNGAIEVGPVMGAVSWPALSESA 385 N A AR ++P WN PSNG +EVGPVMGA SWPALSESA Sbjct: 96 NNNAAARSKKPAWNKPSNGVVEVGPVMGAASWPALSESA 134