BLASTX nr result
ID: Ophiopogon22_contig00015986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00015986 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69204.1| uncharacterized protein A4U43_C05F20430 [Asparagu... 55 1e-06 ref|XP_020264146.1| single myb histone 4-like [Asparagus officin... 55 2e-06 >gb|ONK69204.1| uncharacterized protein A4U43_C05F20430 [Asparagus officinalis] Length = 247 Score = 55.5 bits (132), Expect = 1e-06 Identities = 34/68 (50%), Positives = 38/68 (55%) Frame = -1 Query: 354 SNSVNRVDEVXXXXXXXXXXXXXKSFLAAEAVKEAERVISMHDXXXXXXXXXXEIYERCK 175 SNS + V E KSFLA+EAVKEAER+ SMH+ EIYERC Sbjct: 180 SNSADSVGEAADTIAYKIAESEAKSFLASEAVKEAERIASMHEEAQSLLKLTEEIYERCL 239 Query: 174 RGEVVYLA 151 RGEVV LA Sbjct: 240 RGEVVTLA 247 >ref|XP_020264146.1| single myb histone 4-like [Asparagus officinalis] Length = 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/68 (50%), Positives = 38/68 (55%) Frame = -1 Query: 354 SNSVNRVDEVXXXXXXXXXXXXXKSFLAAEAVKEAERVISMHDXXXXXXXXXXEIYERCK 175 SNS + V E KSFLA+EAVKEAER+ SMH+ EIYERC Sbjct: 208 SNSADSVGEAADTIAYKIAESEAKSFLASEAVKEAERIASMHEEAQSLLKLTEEIYERCL 267 Query: 174 RGEVVYLA 151 RGEVV LA Sbjct: 268 RGEVVTLA 275