BLASTX nr result
ID: Ophiopogon22_contig00014996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014996 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259909.1| nucleolar GTP-binding protein 1-like [Aspara... 123 3e-30 ref|XP_022570352.1| nucleolar GTP-binding protein 1-like, partia... 111 4e-29 gb|KHG27300.1| hypothetical protein F383_34673 [Gossypium arboreum] 112 1e-28 ref|XP_020594617.1| nucleolar GTP-binding protein 1, partial [Ph... 113 2e-28 gb|PHT43479.1| Nucleolar GTP-binding protein 1 [Capsicum baccatum] 110 4e-28 gb|EMS49810.1| Nucleolar GTP-binding protein 1 [Triticum urartu] 115 2e-27 dbj|GAV64986.1| NOG1 domain-containing protein/NOGCT domain-cont... 114 3e-27 ref|XP_003564153.1| PREDICTED: nucleolar GTP-binding protein 1-l... 115 3e-27 ref|XP_020149640.1| nucleolar GTP-binding protein 1-like [Aegilo... 115 3e-27 gb|EMS64602.1| Nucleolar GTP-binding protein 1 [Triticum urartu] 115 3e-27 ref|XP_013720514.1| nucleolar GTP-binding protein 1-like [Brassi... 115 3e-27 ref|XP_020167231.1| nucleolar GTP-binding protein 1-like [Aegilo... 115 3e-27 ref|XP_010256478.1| PREDICTED: nucleolar GTP-binding protein 1-l... 114 4e-27 ref|XP_010243461.1| PREDICTED: nucleolar GTP-binding protein 1-l... 114 4e-27 ref|XP_021616733.1| nucleolar GTP-binding protein 1-like [Maniho... 114 5e-27 gb|KXG19533.1| hypothetical protein SORBI_3010G073200 [Sorghum b... 113 6e-27 ref|XP_020692310.1| nucleolar GTP-binding protein 1-like [Dendro... 114 7e-27 gb|OEL30789.1| Nucleolar GTP-binding protein 1 [Dichanthelium ol... 113 9e-27 ref|XP_021304849.1| nucleolar GTP-binding protein 1-like [Sorghu... 113 9e-27 ref|XP_008807072.1| PREDICTED: nucleolar GTP-binding protein 1-l... 113 9e-27 >ref|XP_020259909.1| nucleolar GTP-binding protein 1-like [Asparagus officinalis] gb|ONK70836.1| uncharacterized protein A4U43_C04F2030 [Asparagus officinalis] Length = 683 Score = 123 bits (309), Expect = 3e-30 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQENF E Sbjct: 1 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQENFSE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_022570352.1| nucleolar GTP-binding protein 1-like, partial [Brassica napus] Length = 121 Score = 111 bits (277), Expect = 4e-29 Identities = 52/61 (85%), Positives = 57/61 (93%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP+ KDFIDI+LSRTQRQTPTVVHKGY INR+RQFYMRKV++TQ NF E Sbjct: 1 MVQYNFKKITVVPNGKDFIDIILSRTQRQTPTVVHKGYKINRLRQFYMRKVKYTQTNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|KHG27300.1| hypothetical protein F383_34673 [Gossypium arboreum] Length = 208 Score = 112 bits (280), Expect = 1e-28 Identities = 52/61 (85%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP+ KDFIDI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKV++TQ+NF E Sbjct: 1 MVQYNFKKITVVPNGKDFIDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVKYTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_020594617.1| nucleolar GTP-binding protein 1, partial [Phalaenopsis equestris] Length = 260 Score = 113 bits (283), Expect = 2e-28 Identities = 52/61 (85%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKIT+VPS K+F+DI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKVRFTQ+NF E Sbjct: 1 MVQYNFKKITIVPSGKEFVDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVRFTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|PHT43479.1| Nucleolar GTP-binding protein 1 [Capsicum baccatum] Length = 165 Score = 110 bits (274), Expect = 4e-28 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP+ KDF+DI+LSRTQRQTPTVVHKGYAI RIRQFYMRKV++TQ+NF + Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQTPTVVHKGYAIARIRQFYMRKVKYTQQNFYD 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|EMS49810.1| Nucleolar GTP-binding protein 1 [Triticum urartu] Length = 631 Score = 115 bits (287), Expect = 2e-27 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQ+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >dbj|GAV64986.1| NOG1 domain-containing protein/NOGCT domain-containing protein, partial [Cephalotus follicularis] Length = 548 Score = 114 bits (286), Expect = 3e-27 Identities = 53/63 (84%), Positives = 61/63 (96%) Frame = -3 Query: 190 VKMVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENF 11 +KMVQYNFKKITVVP+ KDFIDI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKV++TQ+NF Sbjct: 50 LKMVQYNFKKITVVPNGKDFIDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVKYTQQNF 109 Query: 10 QEK 2 EK Sbjct: 110 HEK 112 >ref|XP_003564153.1| PREDICTED: nucleolar GTP-binding protein 1-like [Brachypodium distachyon] gb|KQK19152.1| hypothetical protein BRADI_1g46650v3 [Brachypodium distachyon] gb|KQK19153.1| hypothetical protein BRADI_1g46650v3 [Brachypodium distachyon] Length = 666 Score = 115 bits (287), Expect = 3e-27 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQ+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_020149640.1| nucleolar GTP-binding protein 1-like [Aegilops tauschii subsp. tauschii] Length = 669 Score = 115 bits (287), Expect = 3e-27 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQ+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|EMS64602.1| Nucleolar GTP-binding protein 1 [Triticum urartu] Length = 669 Score = 115 bits (287), Expect = 3e-27 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQ+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_013720514.1| nucleolar GTP-binding protein 1-like [Brassica napus] Length = 675 Score = 115 bits (287), Expect = 3e-27 Identities = 55/68 (80%), Positives = 60/68 (88%) Frame = -3 Query: 205 C*SYPVKMVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRF 26 C S KMVQYNFKKITVVP+ KDFIDI+LSRTQRQTPTVVHKGY INR+RQFYMRKV++ Sbjct: 2 CRSISKKMVQYNFKKITVVPNGKDFIDIILSRTQRQTPTVVHKGYKINRLRQFYMRKVKY 61 Query: 25 TQENFQEK 2 TQ NF EK Sbjct: 62 TQTNFHEK 69 >ref|XP_020167231.1| nucleolar GTP-binding protein 1-like [Aegilops tauschii subsp. tauschii] Length = 678 Score = 115 bits (287), Expect = 3e-27 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR+TQ+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYTQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_010256478.1| PREDICTED: nucleolar GTP-binding protein 1-like [Nelumbo nucifera] ref|XP_019053246.1| PREDICTED: nucleolar GTP-binding protein 1-like [Nelumbo nucifera] Length = 673 Score = 114 bits (286), Expect = 4e-27 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPS KDFIDI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKV+FTQ+NF E Sbjct: 1 MVQYNFKKITVVPSGKDFIDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVKFTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_010243461.1| PREDICTED: nucleolar GTP-binding protein 1-like [Nelumbo nucifera] ref|XP_010243462.1| PREDICTED: nucleolar GTP-binding protein 1-like [Nelumbo nucifera] Length = 677 Score = 114 bits (286), Expect = 4e-27 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPS KDFIDI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKV+FTQ+NF E Sbjct: 1 MVQYNFKKITVVPSGKDFIDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVKFTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_021616733.1| nucleolar GTP-binding protein 1-like [Manihot esculenta] gb|OAY48532.1| hypothetical protein MANES_06G164900 [Manihot esculenta] Length = 680 Score = 114 bits (285), Expect = 5e-27 Identities = 53/61 (86%), Positives = 60/61 (98%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPS KDFIDI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKV++TQ+NF+E Sbjct: 1 MVQYNFKKITVVPSGKDFIDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVKYTQQNFEE 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|KXG19533.1| hypothetical protein SORBI_3010G073200 [Sorghum bicolor] Length = 537 Score = 113 bits (283), Expect = 6e-27 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR++Q+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYSQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_020692310.1| nucleolar GTP-binding protein 1-like [Dendrobium catenatum] ref|XP_020692311.1| nucleolar GTP-binding protein 1-like [Dendrobium catenatum] ref|XP_020692312.1| nucleolar GTP-binding protein 1-like [Dendrobium catenatum] ref|XP_020692313.1| nucleolar GTP-binding protein 1-like [Dendrobium catenatum] gb|PKU72543.1| Nucleolar GTP-binding protein 1 [Dendrobium catenatum] Length = 671 Score = 114 bits (284), Expect = 7e-27 Identities = 53/61 (86%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPS K+F+DI+LSRTQRQTPTVVHKGYAI+R+RQFYMRKVRFTQ+NF E Sbjct: 1 MVQYNFKKITVVPSGKEFVDIILSRTQRQTPTVVHKGYAISRLRQFYMRKVRFTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61 >gb|OEL30789.1| Nucleolar GTP-binding protein 1 [Dichanthelium oligosanthes] Length = 667 Score = 113 bits (283), Expect = 9e-27 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR++Q+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYSQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_021304849.1| nucleolar GTP-binding protein 1-like [Sorghum bicolor] gb|KXG19532.1| hypothetical protein SORBI_3010G073200 [Sorghum bicolor] Length = 669 Score = 113 bits (283), Expect = 9e-27 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVP KDFIDI+LSRTQRQTPTVVHKGYAINRIRQFYMRKVR++Q+NF E Sbjct: 1 MVQYNFKKITVVPPGKDFIDIILSRTQRQTPTVVHKGYAINRIRQFYMRKVRYSQQNFYE 60 Query: 4 K 2 K Sbjct: 61 K 61 >ref|XP_008807072.1| PREDICTED: nucleolar GTP-binding protein 1-like [Phoenix dactylifera] Length = 670 Score = 113 bits (283), Expect = 9e-27 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 184 MVQYNFKKITVVPSCKDFIDIVLSRTQRQTPTVVHKGYAINRIRQFYMRKVRFTQENFQE 5 MVQYNFKKITVVPS KDFIDIVLSRTQRQTPTVVHKGYAI+R+R+FYMRKV+FTQ+NF E Sbjct: 1 MVQYNFKKITVVPSGKDFIDIVLSRTQRQTPTVVHKGYAISRLRKFYMRKVKFTQQNFHE 60 Query: 4 K 2 K Sbjct: 61 K 61