BLASTX nr result
ID: Ophiopogon22_contig00014638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014638 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70077.1| uncharacterized protein A4U43_C05F30000 [Asparagu... 85 1e-16 ref|XP_020265298.1| uncharacterized protein LOC109840888 isoform... 81 8e-16 ref|XP_020265295.1| uncharacterized protein LOC109840888 isoform... 81 2e-15 >gb|ONK70077.1| uncharacterized protein A4U43_C05F30000 [Asparagus officinalis] Length = 370 Score = 85.1 bits (209), Expect = 1e-16 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -1 Query: 139 PLKMFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCFIP 5 PL M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF+P Sbjct: 90 PLNMSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCFLP 134 >ref|XP_020265298.1| uncharacterized protein LOC109840888 isoform X3 [Asparagus officinalis] Length = 223 Score = 80.9 bits (198), Expect = 8e-16 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 130 MFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCFIP 5 M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF+P Sbjct: 1 MSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCFLP 42 >ref|XP_020265295.1| uncharacterized protein LOC109840888 isoform X1 [Asparagus officinalis] ref|XP_020265296.1| uncharacterized protein LOC109840888 isoform X1 [Asparagus officinalis] Length = 278 Score = 80.9 bits (198), Expect = 2e-15 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 130 MFEVPRDNTASPKQHESGPNYFAYYKHLVLDLLSENGTCFIP 5 M E+PRDNTASPKQ+E PNYFAYYKH++LDLLSENGTCF+P Sbjct: 1 MSEIPRDNTASPKQNEFSPNYFAYYKHVILDLLSENGTCFLP 42