BLASTX nr result
ID: Ophiopogon22_contig00014388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014388 (666 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275774.1| 50S ribosomal protein L9, chloroplastic [Asp... 72 5e-12 ref|XP_009799890.1| PREDICTED: 50S ribosomal protein L9, chlorop... 65 2e-10 ref|XP_020581108.1| 50S ribosomal protein L9, chloroplastic [Pha... 67 5e-10 ref|XP_016478398.1| PREDICTED: 50S ribosomal protein L9, chlorop... 65 2e-09 gb|OAY81111.1| 50S ribosomal protein L9, chloroplastic [Ananas c... 65 2e-09 ref|XP_020113487.1| 50S ribosomal protein L9, chloroplastic [Ana... 65 2e-09 ref|XP_021899114.1| 50S ribosomal protein L9, chloroplastic [Car... 64 5e-09 ref|XP_020687625.1| 50S ribosomal protein L9, chloroplastic [Den... 64 5e-09 ref|XP_015577572.1| PREDICTED: 50S ribosomal protein L9, chlorop... 64 8e-09 gb|KDO60291.1| hypothetical protein CISIN_1g029171mg [Citrus sin... 63 9e-09 gb|KMZ59854.1| 50S ribosomal protein L9, chloroplastic [Zostera ... 64 9e-09 ref|XP_010267275.1| PREDICTED: 50S ribosomal protein L9, chlorop... 64 9e-09 gb|PON55367.1| Ribosomal protein [Parasponia andersonii] 64 9e-09 gb|EEF38670.1| 50S ribosomal protein L9, putative [Ricinus commu... 64 1e-08 ref|XP_019258774.1| PREDICTED: 50S ribosomal protein L9, chlorop... 63 1e-08 ref|XP_009601614.1| PREDICTED: 50S ribosomal protein L9, chlorop... 63 1e-08 ref|XP_009356941.1| PREDICTED: 50S ribosomal protein L9, chlorop... 63 1e-08 ref|XP_008385493.1| PREDICTED: 50S ribosomal protein L9, chlorop... 63 1e-08 ref|XP_008377899.1| PREDICTED: 50S ribosomal protein L9, chlorop... 63 1e-08 ref|XP_014519172.1| 50S ribosomal protein L9, chloroplastic [Vig... 63 1e-08 >ref|XP_020275774.1| 50S ribosomal protein L9, chloroplastic [Asparagus officinalis] gb|ONK79471.1| uncharacterized protein A4U43_C01F6700 [Asparagus officinalis] Length = 197 Score = 72.4 bits (176), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 MSELGKKGELLEVK GFFRNYLLPLGKAQ+VTPLLLK Sbjct: 58 MSELGKKGELLEVKAGFFRNYLLPLGKAQIVTPLLLK 94 >ref|XP_009799890.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Nicotiana sylvestris] Length = 89 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKGELL+VK GFFRNYLLPLGKAQ+VTP LLK Sbjct: 53 ITQLGKKGELLDVKAGFFRNYLLPLGKAQIVTPTLLK 89 >ref|XP_020581108.1| 50S ribosomal protein L9, chloroplastic [Phalaenopsis equestris] ref|XP_020581110.1| 50S ribosomal protein L9, chloroplastic [Phalaenopsis equestris] Length = 196 Score = 67.0 bits (162), Expect = 5e-10 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ++ELGKKGELLEVK GF+RN+LLPLGKAQLVTPLL+K Sbjct: 57 VTELGKKGELLEVKAGFYRNFLLPLGKAQLVTPLLIK 93 >ref|XP_016478398.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Nicotiana tabacum] ref|XP_016478399.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Nicotiana tabacum] ref|XP_016478400.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Nicotiana tabacum] Length = 192 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKGELL+VK GFFRNYLLPLGKAQ+VTP LLK Sbjct: 53 ITQLGKKGELLDVKAGFFRNYLLPLGKAQIVTPTLLK 89 >gb|OAY81111.1| 50S ribosomal protein L9, chloroplastic [Ananas comosus] Length = 179 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +SELGKKG++LEVK G++RNYL PLGKAQ+VTPLLLK Sbjct: 56 VSELGKKGQMLEVKAGYYRNYLFPLGKAQIVTPLLLK 92 >ref|XP_020113487.1| 50S ribosomal protein L9, chloroplastic [Ananas comosus] Length = 195 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +SELGKKG++LEVK G++RNYL PLGKAQ+VTPLLLK Sbjct: 56 VSELGKKGQMLEVKAGYYRNYLFPLGKAQIVTPLLLK 92 >ref|XP_021899114.1| 50S ribosomal protein L9, chloroplastic [Carica papaya] Length = 196 Score = 64.3 bits (155), Expect = 5e-09 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKG+LL+VK G+FRNYLLP+GKAQ+VTPLLLK Sbjct: 57 VADLGKKGQLLDVKAGYFRNYLLPMGKAQIVTPLLLK 93 >ref|XP_020687625.1| 50S ribosomal protein L9, chloroplastic [Dendrobium catenatum] ref|XP_020687626.1| 50S ribosomal protein L9, chloroplastic [Dendrobium catenatum] gb|PKU83632.1| 50S ribosomal protein L9, chloroplastic [Dendrobium catenatum] Length = 196 Score = 64.3 bits (155), Expect = 5e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ++ELGKKGELLEVK GF+RN+L PLGKAQ+VTPLL+K Sbjct: 57 VTELGKKGELLEVKAGFYRNFLFPLGKAQIVTPLLVK 93 >ref|XP_015577572.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Ricinus communis] Length = 191 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +S+LGKKG+LL+VK GF+RNYLLP+GKAQ+VTP LLK Sbjct: 58 VSDLGKKGQLLDVKAGFYRNYLLPMGKAQIVTPTLLK 94 >gb|KDO60291.1| hypothetical protein CISIN_1g029171mg [Citrus sinensis] Length = 157 Score = 62.8 bits (151), Expect = 9e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ++ELGKKG+LL+VK GF+RNYL P+GKAQ+VTPLLLK Sbjct: 18 VAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLLK 54 >gb|KMZ59854.1| 50S ribosomal protein L9, chloroplastic [Zostera marina] Length = 194 Score = 63.5 bits (153), Expect = 9e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +SELG KG+L+EVK GFFRNYL PLGKAQ+VTPLL+K Sbjct: 55 VSELGMKGQLVEVKAGFFRNYLFPLGKAQIVTPLLVK 91 >ref|XP_010267275.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nelumbo nucifera] Length = 195 Score = 63.5 bits (153), Expect = 9e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 9 ELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ELGKKG+LL+VK GF+RNYLLP+GKAQ+VTP+LLK Sbjct: 58 ELGKKGQLLDVKAGFYRNYLLPMGKAQIVTPVLLK 92 >gb|PON55367.1| Ribosomal protein [Parasponia andersonii] Length = 196 Score = 63.5 bits (153), Expect = 9e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ++ELGKKGELL VK GF+RNYLLP GKAQ+VTP+LLK Sbjct: 57 IAELGKKGELLHVKAGFYRNYLLPTGKAQIVTPVLLK 93 >gb|EEF38670.1| 50S ribosomal protein L9, putative [Ricinus communis] Length = 210 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +S+LGKKG+LL+VK GF+RNYLLP+GKAQ+VTP LLK Sbjct: 58 VSDLGKKGQLLDVKAGFYRNYLLPMGKAQIVTPTLLK 94 >ref|XP_019258774.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nicotiana attenuata] gb|OIT40304.1| 50s ribosomal protein l9, chloroplastic [Nicotiana attenuata] Length = 192 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKGELL+VK GFFRNYLLPLG AQ+VTP LLK Sbjct: 53 ITQLGKKGELLDVKAGFFRNYLLPLGMAQIVTPTLLK 89 >ref|XP_009601614.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nicotiana tomentosiformis] ref|XP_016498580.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Nicotiana tabacum] ref|XP_018626574.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nicotiana tomentosiformis] ref|XP_018626575.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nicotiana tomentosiformis] Length = 192 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKGELL+VK GFFRNYLLPLG AQ+VTP LLK Sbjct: 53 ITQLGKKGELLDVKAGFFRNYLLPLGMAQIVTPTLLK 89 >ref|XP_009356941.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Pyrus x bretschneideri] Length = 195 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKG+LL VK G++RNYLLPLGKAQ+VTPLLLK Sbjct: 56 ITDLGKKGQLLSVKAGYYRNYLLPLGKAQIVTPLLLK 92 >ref|XP_008385493.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Malus domestica] Length = 195 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKG+LL VK G++RNYLLPLGKAQ+VTPLLLK Sbjct: 56 ITDLGKKGQLLSVKAGYYRNYLLPLGKAQIVTPLLLK 92 >ref|XP_008377899.1| PREDICTED: 50S ribosomal protein L9, chloroplastic-like [Malus domestica] Length = 195 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 +++LGKKG+LL VK G++RNYLLPLGKAQ+VTPLLLK Sbjct: 56 ITDLGKKGQLLSVKAGYYRNYLLPLGKAQIVTPLLLK 92 >ref|XP_014519172.1| 50S ribosomal protein L9, chloroplastic [Vigna radiata var. radiata] Length = 196 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = +3 Query: 3 MSELGKKGELLEVKPGFFRNYLLPLGKAQLVTPLLLK 113 ++++GK+G+LL+VK GF+RNYLLPLGKAQLVTPLLLK Sbjct: 57 VADVGKQGQLLDVKAGFYRNYLLPLGKAQLVTPLLLK 93