BLASTX nr result
ID: Ophiopogon22_contig00014182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014182 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70170.1| uncharacterized protein A4U43_C05F30990 [Asparagu... 95 2e-19 gb|OAY69399.1| U-box domain-containing protein 35 [Ananas comosus] 70 6e-11 ref|XP_009380166.1| PREDICTED: U-box domain-containing protein 5... 69 1e-10 ref|XP_020090728.1| U-box domain-containing protein 52-like isof... 69 1e-10 ref|XP_020090727.1| U-box domain-containing protein 52-like isof... 69 1e-10 ref|XP_008798198.1| PREDICTED: U-box domain-containing protein 5... 67 7e-10 ref|XP_019707576.1| PREDICTED: U-box domain-containing protein 5... 65 3e-09 ref|XP_003564167.1| PREDICTED: U-box domain-containing protein 5... 65 6e-09 gb|PKU63938.1| U-box domain-containing protein 35 [Dendrobium ca... 59 4e-07 ref|XP_020689458.1| U-box domain-containing protein 52-like isof... 59 4e-07 ref|XP_020689457.1| U-box domain-containing protein 52-like isof... 59 4e-07 ref|XP_020108087.1| U-box domain-containing protein 51-like isof... 59 4e-07 ref|XP_020108079.1| U-box domain-containing protein 51-like isof... 59 4e-07 gb|OAY79813.1| U-box domain-containing protein 51 [Ananas comosus] 59 4e-07 gb|PKA57879.1| U-box domain-containing protein 35 [Apostasia she... 58 1e-06 ref|XP_018682215.1| PREDICTED: U-box domain-containing protein 5... 56 5e-06 >gb|ONK70170.1| uncharacterized protein A4U43_C05F30990 [Asparagus officinalis] Length = 771 Score = 94.7 bits (234), Expect = 2e-19 Identities = 62/94 (65%), Positives = 65/94 (69%), Gaps = 19/94 (20%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPD--GADISFV-SSGMSSG----------RMSIDHMYL 194 +SPFSRGARGC NIKSFAEL+L GADISFV SSGMSSG R SID MY Sbjct: 221 KSPFSRGARGCSNIKSFAELSLSSDGGADISFVSSSGMSSGRPSIDRPSIDRPSIDRMYP 280 Query: 193 PRLSNGSDSL-----ESTRTPHRLS-DAYSIGND 110 PRLSN SDSL S+ TPHR S DAYSIGND Sbjct: 281 PRLSNVSDSLNHSFESSSHTPHRSSADAYSIGND 314 >gb|OAY69399.1| U-box domain-containing protein 35 [Ananas comosus] Length = 719 Score = 70.5 bits (171), Expect = 6e-11 Identities = 42/80 (52%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHM-YLPRLSNGSD---- 170 RSPF+RG RG KS+A+L +PD DISFV SSGR S+D + PRLS+GS+ Sbjct: 229 RSPFTRGGRGTTR-KSYADLPMPDSTDISFV----SSGRPSVDRCPFPPRLSSGSEGFDS 283 Query: 169 SLESTRTPHRLSDAYSIGND 110 S E RTPHR D+YS N+ Sbjct: 284 SFEMVRTPHRSMDSYSTSNE 303 >ref|XP_009380166.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] Length = 736 Score = 69.3 bits (168), Expect = 1e-10 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 3/78 (3%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLEST 155 RSPF RG G KSFA+L+L D DISFVSSG R S D + PRLSNGSD L+ + Sbjct: 224 RSPFGRGMGGATT-KSFADLSLSD-TDISFVSSG----RPSTDQAFPPRLSNGSDGLDRS 277 Query: 154 ---RTPHRLSDAYSIGND 110 RTPH+ D+YS GN+ Sbjct: 278 FEMRTPHKSVDSYSTGNE 295 >ref|XP_020090728.1| U-box domain-containing protein 52-like isoform X2 [Ananas comosus] Length = 764 Score = 69.3 bits (168), Expect = 1e-10 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHM-YLPRLSNGSD---- 170 +SPF+RG RG KS+A+L +PD DISFV SSGR S+D + PRLS+GS+ Sbjct: 214 KSPFTRGGRGTTR-KSYADLPMPDSTDISFV----SSGRPSVDRCPFPPRLSSGSEGFDS 268 Query: 169 SLESTRTPHRLSDAYSIGND 110 S E RTPHR D+YS N+ Sbjct: 269 SFEMVRTPHRSMDSYSTSNE 288 >ref|XP_020090727.1| U-box domain-containing protein 52-like isoform X1 [Ananas comosus] Length = 765 Score = 69.3 bits (168), Expect = 1e-10 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHM-YLPRLSNGSD---- 170 +SPF+RG RG KS+A+L +PD DISFV SSGR S+D + PRLS+GS+ Sbjct: 215 KSPFTRGGRGTTR-KSYADLPMPDSTDISFV----SSGRPSVDRCPFPPRLSSGSEGFDS 269 Query: 169 SLESTRTPHRLSDAYSIGND 110 S E RTPHR D+YS N+ Sbjct: 270 SFEMVRTPHRSMDSYSTSNE 289 >ref|XP_008798198.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera] Length = 788 Score = 67.4 bits (163), Expect = 7e-10 Identities = 40/80 (50%), Positives = 54/80 (67%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSL--- 164 +SPF+RG RG KS+ +L+ PD +DISFVSSG R S+D MY PRLS+GS++L Sbjct: 219 KSPFARGMRGM-TAKSYTDLSFPD-SDISFVSSG----RPSVDRMYPPRLSSGSEALDHR 272 Query: 163 --ESTRTPHRLSDAYSIGND 110 E TP + +D++S GND Sbjct: 273 SFEMVTTPMKSADSFSTGND 292 >ref|XP_019707576.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis] Length = 765 Score = 65.5 bits (158), Expect = 3e-09 Identities = 40/79 (50%), Positives = 52/79 (65%), Gaps = 4/79 (5%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSL--- 164 +SPF+RG RG KS+A+ + D +DISFVSSG R S+D MY PRLS GS+SL Sbjct: 219 KSPFARGMRGT-TAKSYADFSFTD-SDISFVSSG----RPSVDRMYPPRLSTGSESLDRS 272 Query: 163 -ESTRTPHRLSDAYSIGND 110 E TP + +D++S GND Sbjct: 273 FEMVTTPMKSADSFSTGND 291 >ref|XP_003564167.1| PREDICTED: U-box domain-containing protein 52-like [Brachypodium distachyon] gb|PNT76303.1| hypothetical protein BRADI_1g46860v3 [Brachypodium distachyon] Length = 795 Score = 64.7 bits (156), Expect = 6e-09 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 8/81 (9%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELA---LPDGADISFVSSGMSSGRMSIDHMYLPRLSNGS--D 170 RSPF+RG+ G P KS+A+L+ +PD ADISFVS G GR SID PR+SNGS D Sbjct: 227 RSPFTRGSMG-PTRKSYADLSHMSMPDSADISFVSGGGGGGRRSIDFYQQPRMSNGSSID 285 Query: 169 SLEST---RTPHRLSDAYSIG 116 S + + RTP + D++ G Sbjct: 286 SYDHSFEMRTPSKWGDSFGGG 306 >gb|PKU63938.1| U-box domain-containing protein 35 [Dendrobium catenatum] Length = 729 Score = 59.3 bits (142), Expect = 4e-07 Identities = 41/79 (51%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD----S 167 +SPF+RG R +KS A+L D DISFVS SGR SID + PR SN SD S Sbjct: 228 KSPFTRGNR----VKSNADLLYND-TDISFVS----SGRPSIDRSFQPRHSNASDGHDHS 278 Query: 166 LESTRTPHRLSDAYSIGND 110 ES RTP R D+YS GN+ Sbjct: 279 FESARTPIRSVDSYSFGNE 297 >ref|XP_020689458.1| U-box domain-containing protein 52-like isoform X2 [Dendrobium catenatum] Length = 760 Score = 59.3 bits (142), Expect = 4e-07 Identities = 41/79 (51%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD----S 167 +SPF+RG R +KS A+L D DISFVS SGR SID + PR SN SD S Sbjct: 213 KSPFTRGNR----VKSNADLLYND-TDISFVS----SGRPSIDRSFQPRHSNASDGHDHS 263 Query: 166 LESTRTPHRLSDAYSIGND 110 ES RTP R D+YS GN+ Sbjct: 264 FESARTPIRSVDSYSFGNE 282 >ref|XP_020689457.1| U-box domain-containing protein 52-like isoform X1 [Dendrobium catenatum] Length = 761 Score = 59.3 bits (142), Expect = 4e-07 Identities = 41/79 (51%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD----S 167 +SPF+RG R +KS A+L D DISFVS SGR SID + PR SN SD S Sbjct: 214 KSPFTRGNR----VKSNADLLYND-TDISFVS----SGRPSIDRSFQPRHSNASDGHDHS 264 Query: 166 LESTRTPHRLSDAYSIGND 110 ES RTP R D+YS GN+ Sbjct: 265 FESARTPIRSVDSYSFGNE 283 >ref|XP_020108087.1| U-box domain-containing protein 51-like isoform X2 [Ananas comosus] Length = 778 Score = 59.3 bits (142), Expect = 4e-07 Identities = 40/81 (49%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGA-DISFVSSGMSSGRMSID-HMYLPRLSNGSDSL- 164 +SPF+RG RG KS+A+ A D + DISFVSSG R S+D + Y PRLS+GS+ L Sbjct: 215 KSPFTRGLRGS-TAKSYADFAFMDSSSDISFVSSG----RPSVDRYQYPPRLSSGSEGLD 269 Query: 163 ---ESTRTPHRLSDAYSIGND 110 E+ RTP D+YS ND Sbjct: 270 RSFETVRTPQTSVDSYSTRND 290 >ref|XP_020108079.1| U-box domain-containing protein 51-like isoform X1 [Ananas comosus] Length = 779 Score = 59.3 bits (142), Expect = 4e-07 Identities = 40/81 (49%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGA-DISFVSSGMSSGRMSID-HMYLPRLSNGSDSL- 164 +SPF+RG RG KS+A+ A D + DISFVSSG R S+D + Y PRLS+GS+ L Sbjct: 216 KSPFTRGLRGS-TAKSYADFAFMDSSSDISFVSSG----RPSVDRYQYPPRLSSGSEGLD 270 Query: 163 ---ESTRTPHRLSDAYSIGND 110 E+ RTP D+YS ND Sbjct: 271 RSFETVRTPQTSVDSYSTRND 291 >gb|OAY79813.1| U-box domain-containing protein 51 [Ananas comosus] Length = 903 Score = 59.3 bits (142), Expect = 4e-07 Identities = 40/81 (49%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGA-DISFVSSGMSSGRMSID-HMYLPRLSNGSDSL- 164 +SPF+RG RG KS+A+ A D + DISFVSSG R S+D + Y PRLS+GS+ L Sbjct: 261 KSPFTRGLRGS-TAKSYADFAFMDSSSDISFVSSG----RPSVDRYQYPPRLSSGSEGLD 315 Query: 163 ---ESTRTPHRLSDAYSIGND 110 E+ RTP D+YS ND Sbjct: 316 RSFETVRTPQTSVDSYSTRND 336 >gb|PKA57879.1| U-box domain-containing protein 35 [Apostasia shenzhenica] Length = 770 Score = 57.8 bits (138), Expect = 1e-06 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSDSLEST 155 +SPF+RG+RG KS+A+L+L DISFV+SG R SID ++ PR SN SD ++ + Sbjct: 210 KSPFTRGSRG----KSYADLSLA-ATDISFVTSG----RPSIDKVFQPRASNASDGVDHS 260 Query: 154 -----RTPHRLSDAYSIGND 110 TP R +++YS GN+ Sbjct: 261 FESVCMTPLRSAESYSFGNE 280 >ref|XP_018682215.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] ref|XP_018682216.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata subsp. malaccensis] Length = 823 Score = 56.2 bits (134), Expect = 5e-06 Identities = 39/80 (48%), Positives = 50/80 (62%), Gaps = 5/80 (6%) Frame = -2 Query: 334 RSPFSRGARGCPNIKSFAELALPDGADISFVSSGMSSGRMSIDHMYLPRLSNGSD----S 167 +SP++RG R + A+L+L D DISFVSSG R SID + PRLSNGSD S Sbjct: 276 KSPYARGMRA----STIADLSLSD-TDISFVSSG----RPSIDQAFPPRLSNGSDGLDRS 326 Query: 166 LESTRTP-HRLSDAYSIGND 110 E TP +R +D+YS GN+ Sbjct: 327 FEMALTPNNRSADSYSTGNE 346