BLASTX nr result
ID: Ophiopogon22_contig00014077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014077 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008812340.1| PREDICTED: COP9 signalosome complex subunit ... 59 1e-07 ref|XP_020672830.1| COP9 signalosome complex subunit 3-like, par... 58 3e-07 gb|ONK72432.1| uncharacterized protein A4U43_C04F19370 [Asparagu... 57 5e-07 ref|XP_020261492.1| COP9 signalosome complex subunit 3 [Asparagu... 57 5e-07 gb|PKA65925.1| COP9 signalosome complex subunit 3 [Apostasia she... 56 1e-06 ref|XP_010943897.1| PREDICTED: COP9 signalosome complex subunit ... 56 2e-06 gb|OAY73938.1| COP9 signalosome complex subunit 3 [Ananas comosus] 54 5e-06 >ref|XP_008812340.1| PREDICTED: COP9 signalosome complex subunit 3 [Phoenix dactylifera] Length = 424 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 110 EAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 EAYS GPI REQASG+L T V FINSCS EQIRL P Sbjct: 63 EAYSSGPILREQASGYLLTVVEFINSCSAEQIRLTP 98 >ref|XP_020672830.1| COP9 signalosome complex subunit 3-like, partial [Dendrobium catenatum] Length = 377 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -1 Query: 122 MFDREAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 +F REAYS GPI RE S FLA V FIN CS EQIRLAP Sbjct: 14 LFHREAYSSGPILRENISSFLACVVGFINFCSSEQIRLAP 53 >gb|ONK72432.1| uncharacterized protein A4U43_C04F19370 [Asparagus officinalis] Length = 360 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 113 REAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 ++A+S PI REQASGFL V+FINSCSEEQIRLAP Sbjct: 36 KDAFSSRPIIREQASGFLVIVVNFINSCSEEQIRLAP 72 >ref|XP_020261492.1| COP9 signalosome complex subunit 3 [Asparagus officinalis] Length = 422 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 122 MFDREAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 +F +A+S PI REQASGFL V+FINSCSEEQIRLAP Sbjct: 59 LFLLDAFSSRPIIREQASGFLVIVVNFINSCSEEQIRLAP 98 >gb|PKA65925.1| COP9 signalosome complex subunit 3 [Apostasia shenzhenica] Length = 314 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 110 EAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 EAYS GPI+REQAS L + V FINSCS EQIRLAP Sbjct: 63 EAYSSGPITREQASALLISFVGFINSCSAEQIRLAP 98 >ref|XP_010943897.1| PREDICTED: COP9 signalosome complex subunit 3 [Elaeis guineensis] ref|XP_010943898.1| PREDICTED: COP9 signalosome complex subunit 3 [Elaeis guineensis] Length = 424 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 110 EAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 EAYS GP+ EQASG+L T V FI+SCS EQIRLAP Sbjct: 63 EAYSSGPLLEEQASGYLLTVVEFIDSCSAEQIRLAP 98 >gb|OAY73938.1| COP9 signalosome complex subunit 3 [Ananas comosus] Length = 200 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 110 EAYSGGPISREQASGFLATAVSFINSCSEEQIRLAP 3 EAY GPIS +QA GFL + V FINSCS +QIRLAP Sbjct: 64 EAYLSGPISSDQAGGFLLSVVDFINSCSGDQIRLAP 99