BLASTX nr result
ID: Ophiopogon22_contig00014005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00014005 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO44427.1| hypothetical protein CISIN_1g0281851mg, partial [... 56 6e-07 ref|XP_015572724.1| PREDICTED: uncharacterized protein At2g38710... 58 6e-07 gb|OMP09767.1| hypothetical protein COLO4_05151 [Corchorus olito... 59 1e-06 gb|ESR58986.1| hypothetical protein CICLE_v10016681mg [Citrus cl... 56 1e-06 gb|OAY24152.1| hypothetical protein MANES_18G138700 [Manihot esc... 55 3e-06 ref|XP_006445745.1| uncharacterized protein At2g38710 [Citrus cl... 56 3e-06 ref|XP_010933479.1| PREDICTED: uncharacterized protein At2g38710... 55 8e-06 >gb|KDO44427.1| hypothetical protein CISIN_1g0281851mg, partial [Citrus sinensis] gb|KDO44428.1| hypothetical protein CISIN_1g0281851mg, partial [Citrus sinensis] Length = 113 Score = 56.2 bits (134), Expect = 6e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGE 503 AVYCFDTLVAHY+SEDAPPPAF+EG+ Sbjct: 9 AVYCFDTLVAHYNSEDAPPPAFDEGQ 34 >ref|XP_015572724.1| PREDICTED: uncharacterized protein At2g38710 isoform X1 [Ricinus communis] Length = 216 Score = 58.2 bits (139), Expect = 6e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGEQY 497 AVYCFDTL+AHY+SE+APPPAF+EG+QY Sbjct: 9 AVYCFDTLLAHYNSEEAPPPAFDEGQQY 36 >gb|OMP09767.1| hypothetical protein COLO4_05151 [Corchorus olitorius] Length = 427 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGEQYDVGF--RIFNLPMVKPHFPPTVA 434 AVYCFDTLVAHY+SE+APPPAF+EG+Q F + + + + P F P +A Sbjct: 9 AVYCFDTLVAHYNSEEAPPPAFDEGQQKFTTFCSQFYAVLLNAPSFGPLLA 59 >gb|ESR58986.1| hypothetical protein CICLE_v10016681mg [Citrus clementina] Length = 155 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGE 503 AVYCFDTLVAHY+SEDAPPPAF+EG+ Sbjct: 9 AVYCFDTLVAHYNSEDAPPPAFDEGQ 34 >gb|OAY24152.1| hypothetical protein MANES_18G138700 [Manihot esculenta] Length = 120 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGE 503 AVYCFDTLVAHY+SE+APPPAF+EG+ Sbjct: 9 AVYCFDTLVAHYNSEEAPPPAFDEGQ 34 >ref|XP_006445745.1| uncharacterized protein At2g38710 [Citrus clementina] ref|XP_006485185.1| PREDICTED: uncharacterized protein At2g38710 [Citrus sinensis] gb|ESR58985.1| hypothetical protein CICLE_v10016681mg [Citrus clementina] dbj|GAY54002.1| hypothetical protein CUMW_153260 [Citrus unshiu] Length = 212 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGE 503 AVYCFDTLVAHY+SEDAPPPAF+EG+ Sbjct: 9 AVYCFDTLVAHYNSEDAPPPAFDEGQ 34 >ref|XP_010933479.1| PREDICTED: uncharacterized protein At2g38710 [Elaeis guineensis] Length = 211 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 580 AVYCFDTLVAHYSSEDAPPPAFEEGE 503 AVYCFDTLVAHY+SE APPPAFEEG+ Sbjct: 9 AVYCFDTLVAHYNSEQAPPPAFEEGQ 34