BLASTX nr result
ID: Ophiopogon22_contig00013572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00013572 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK78193.1| uncharacterized protein A4U43_C02F15510 [Asparagu... 96 6e-22 ref|XP_020254133.1| probable BOI-related E3 ubiquitin-protein li... 96 2e-21 gb|PIA40680.1| hypothetical protein AQUCO_02400026v1 [Aquilegia ... 87 4e-17 gb|OVA09742.1| zinc finger protein [Macleaya cordata] 88 4e-17 ref|XP_009380014.1| PREDICTED: BOI-related E3 ubiquitin-protein ... 86 1e-16 ref|XP_009404199.1| PREDICTED: probable BOI-related E3 ubiquitin... 85 2e-16 ref|XP_010909318.1| PREDICTED: probable BOI-related E3 ubiquitin... 85 2e-16 ref|XP_010909317.1| PREDICTED: probable BOI-related E3 ubiquitin... 85 2e-16 ref|XP_002975512.1| hypothetical protein SELMODRAFT_103907 [Sela... 83 3e-16 ref|XP_008809947.1| PREDICTED: probable BOI-related E3 ubiquitin... 83 2e-15 ref|XP_006844713.1| probable BOI-related E3 ubiquitin-protein li... 82 3e-15 gb|OAE24553.1| hypothetical protein AXG93_2415s1320 [Marchantia ... 82 5e-15 ref|XP_001770762.1| predicted protein [Physcomitrella patens] 80 7e-15 ref|XP_001752458.1| predicted protein [Physcomitrella patens] 79 9e-15 ref|XP_010942314.1| PREDICTED: probable BOI-related E3 ubiquitin... 81 1e-14 ref|XP_010942313.1| PREDICTED: probable BOI-related E3 ubiquitin... 81 1e-14 ref|XP_010249378.1| PREDICTED: probable BOI-related E3 ubiquitin... 80 1e-14 ref|XP_010249377.1| PREDICTED: probable BOI-related E3 ubiquitin... 80 1e-14 ref|XP_020677935.1| probable BOI-related E3 ubiquitin-protein li... 80 1e-14 ref|XP_008797654.1| PREDICTED: probable BOI-related E3 ubiquitin... 79 2e-14 >gb|ONK78193.1| uncharacterized protein A4U43_C02F15510 [Asparagus officinalis] Length = 168 Score = 96.3 bits (238), Expect = 6e-22 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 R+ C++C EKDVSVLLLPCRHLCLC+DCE++ DTCPICHV KNA LQI+MS Sbjct: 118 RRNCKICGEKDVSVLLLPCRHLCLCRDCEARVDTCPICHVTKNASLQIFMS 168 >ref|XP_020254133.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Asparagus officinalis] Length = 227 Score = 96.3 bits (238), Expect = 2e-21 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 R+ C++C EKDVSVLLLPCRHLCLC+DCE++ DTCPICHV KNA LQI+MS Sbjct: 177 RRNCKICGEKDVSVLLLPCRHLCLCRDCEARVDTCPICHVTKNASLQIFMS 227 >gb|PIA40680.1| hypothetical protein AQUCO_02400026v1 [Aquilegia coerulea] Length = 326 Score = 87.0 bits (214), Expect = 4e-17 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 RK C+VC E +VSVLLLPCRHLCLCK+CESK DTCPIC+ KNA LQI++S Sbjct: 276 RKYCKVCHENEVSVLLLPCRHLCLCKNCESKLDTCPICNSLKNASLQIFIS 326 >gb|OVA09742.1| zinc finger protein [Macleaya cordata] Length = 414 Score = 87.8 bits (216), Expect = 4e-17 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 RK C+VC E +VSVLLLPCRHLCLCKDCESK D CPIC KNA LQI+MS Sbjct: 364 RKSCKVCGENEVSVLLLPCRHLCLCKDCESKLDYCPICKSMKNASLQIFMS 414 >ref|XP_009380014.1| PREDICTED: BOI-related E3 ubiquitin-protein ligase 1-like [Musa acuminata subsp. malaccensis] Length = 352 Score = 85.9 bits (211), Expect = 1e-16 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 +R+ C+ C E+DVS+LLLPCRHLCLCKDCE+KAD CP+C KNA LQ++M Sbjct: 301 WRRACKACGERDVSILLLPCRHLCLCKDCEAKADACPVCGSAKNAYLQVFM 351 >ref|XP_009404199.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 322 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 RK C+ C E+DV VLLLPCRH+C+CKDCESK DTCP+C KNA LQ++M Sbjct: 272 RKACKACGERDVCVLLLPCRHVCVCKDCESKTDTCPVCGSTKNAYLQVFM 321 >ref|XP_010909318.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 isoform X2 [Elaeis guineensis] Length = 339 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 +R+ C+VC K+ + +LLPCRHLCLCKDCES DTCPIC +KNAC QIY+S Sbjct: 288 WRRPCKVCGVKEATFVLLPCRHLCLCKDCESMVDTCPICQSSKNACFQIYLS 339 >ref|XP_010909317.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X1 [Elaeis guineensis] Length = 351 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 +R+ C+VC K+ + +LLPCRHLCLCKDCES DTCPIC +KNAC QIY+S Sbjct: 300 WRRPCKVCGVKEATFVLLPCRHLCLCKDCESMVDTCPICQSSKNACFQIYLS 351 >ref|XP_002975512.1| hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii] ref|XP_002993531.1| hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii] gb|EFJ05423.1| hypothetical protein SELMODRAFT_137185 [Selaginella moellendorffii] gb|EFJ23141.1| hypothetical protein SELMODRAFT_103907 [Selaginella moellendorffii] Length = 246 Score = 83.2 bits (204), Expect = 3e-16 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 ++ CRVC DV +LLLPCRHLCLCK+CE++ DTCP+C +KNA +Q+YMS Sbjct: 196 KRTCRVCRSNDVCILLLPCRHLCLCKECEARLDTCPLCRHSKNASVQVYMS 246 >ref|XP_008809947.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Phoenix dactylifera] Length = 348 Score = 82.8 bits (203), Expect = 2e-15 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 +R+ C+VC EK+V+ +LLPCRHLCLCKDCES DTCPIC KNA QI+M Sbjct: 297 WRRSCKVCGEKEVTFVLLPCRHLCLCKDCESMTDTCPICQAWKNASFQIFM 347 >ref|XP_006844713.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Amborella trichopoda] gb|ERN06388.1| hypothetical protein AMTR_s00016p00251370 [Amborella trichopoda] Length = 354 Score = 82.0 bits (201), Expect = 3e-15 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 R+ C++C + ++S+LLLPCRHLCLCKDCESK D CP+C+ KNA LQI++ Sbjct: 305 RRTCKICRKSEISILLLPCRHLCLCKDCESKFDVCPLCNSRKNASLQIHL 354 >gb|OAE24553.1| hypothetical protein AXG93_2415s1320 [Marchantia polymorpha subsp. ruderalis] Length = 374 Score = 81.6 bits (200), Expect = 5e-15 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 ++ CRVC DVS+LLLPCRHLCLCKDCE ++ TCP+C KNA +Q+YMS Sbjct: 324 QRTCRVCRCNDVSILLLPCRHLCLCKDCEGRSTTCPLCQSPKNASVQVYMS 374 >ref|XP_001770762.1| predicted protein [Physcomitrella patens] Length = 268 Score = 80.1 bits (196), Expect = 7e-15 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 ++ CR C DVS+LLLPCRHLCLCKDCE++ D CP+C KNA +Q+YMS Sbjct: 218 QRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDVCPLCQTLKNASVQVYMS 268 >ref|XP_001752458.1| predicted protein [Physcomitrella patens] Length = 206 Score = 78.6 bits (192), Expect = 9e-15 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 ++ CR C DVS+LLLPCRHLCLCKDCE++ D CP+C KNA +Q+YM Sbjct: 157 QRTCRSCRCNDVSILLLPCRHLCLCKDCEARLDACPLCQTLKNASVQVYM 206 >ref|XP_010942314.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X2 [Elaeis guineensis] Length = 383 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 +R+ C++C EKDV VLL PCRHLCLCKDCE DTCPIC K+ LQI+MS Sbjct: 332 WRRACKICQEKDVCVLLFPCRHLCLCKDCEPMVDTCPICQSVKSDFLQIFMS 383 >ref|XP_010942313.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X1 [Elaeis guineensis] Length = 384 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +3 Query: 6 FRKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 +R+ C++C EKDV VLL PCRHLCLCKDCE DTCPIC K+ LQI+MS Sbjct: 333 WRRACKICQEKDVCVLLFPCRHLCLCKDCEPMVDTCPICQSVKSDFLQIFMS 384 >ref|XP_010249378.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X2 [Nelumbo nucifera] Length = 342 Score = 80.5 bits (197), Expect = 1e-14 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 R RC+VC EK+VSVLLLPCRHLC+CK CES+ CP+C+ KNA LQI MS Sbjct: 292 RTRCKVCREKEVSVLLLPCRHLCVCKVCESRLSICPVCNSIKNATLQIVMS 342 >ref|XP_010249377.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 isoform X1 [Nelumbo nucifera] Length = 343 Score = 80.5 bits (197), Expect = 1e-14 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 R RC+VC EK+VSVLLLPCRHLC+CK CES+ CP+C+ KNA LQI MS Sbjct: 293 RTRCKVCREKEVSVLLLPCRHLCVCKVCESRLSICPVCNSIKNATLQIVMS 343 >ref|XP_020677935.1| probable BOI-related E3 ubiquitin-protein ligase 2 [Dendrobium catenatum] gb|PKU79548.1| hypothetical protein MA16_Dca000894 [Dendrobium catenatum] Length = 350 Score = 80.5 bits (197), Expect = 1e-14 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYMS 161 R C+VC E D+ VL+LPCRHLCLCK C++ DTCP CH KNA LQI+MS Sbjct: 300 RMVCKVCNENDICVLVLPCRHLCLCKSCDAGVDTCPTCHYPKNATLQIFMS 350 >ref|XP_008797654.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Phoenix dactylifera] Length = 294 Score = 79.3 bits (194), Expect = 2e-14 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +3 Query: 9 RKRCRVCCEKDVSVLLLPCRHLCLCKDCESKADTCPICHVNKNACLQIYM 158 R+ C+ C +KDV VLLLPCRHLCLC CE K DTCPICH KNA L+I++ Sbjct: 244 RRGCKACRDKDVCVLLLPCRHLCLCVACEPKIDTCPICHSVKNASLEIFL 293