BLASTX nr result
ID: Ophiopogon22_contig00013375
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00013375 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265851.1| uncharacterized protein LOC109841327 [Aspara... 73 4e-12 >ref|XP_020265851.1| uncharacterized protein LOC109841327 [Asparagus officinalis] gb|ONK70541.1| uncharacterized protein A4U43_C05F34780 [Asparagus officinalis] Length = 353 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -3 Query: 462 RSRNCFNSCKESPKSSGIQQIGRVSGFQRHFQGSQTNKHSLR 337 RSRNCF SCKESPK S +QQIGRV G QRHFQGSQ N SLR Sbjct: 292 RSRNCFGSCKESPKGSSVQQIGRVGGLQRHFQGSQYNNRSLR 333