BLASTX nr result
ID: Ophiopogon22_contig00013189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00013189 (638 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241415.1| pentatricopeptide repeat-containing protein ... 128 9e-31 ref|XP_020681538.1| pentatricopeptide repeat-containing protein ... 71 1e-10 ref|XP_010523919.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_009408591.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|XP_020577272.1| pentatricopeptide repeat-containing protein ... 67 2e-09 ref|XP_023750633.1| pentatricopeptide repeat-containing protein ... 67 3e-09 ref|XP_007047157.2| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|EOX91314.1| Pentatricopeptide repeat (PPR) superfamily protei... 67 3e-09 gb|PKA53904.1| Pentatricopeptide repeat-containing protein [Apos... 66 5e-09 ref|XP_020099587.1| pentatricopeptide repeat-containing protein ... 65 9e-09 gb|OAY75655.1| Pentatricopeptide repeat-containing protein [Anan... 65 9e-09 gb|PIA47212.1| hypothetical protein AQUCO_01400121v1 [Aquilegia ... 65 9e-09 ref|XP_018472342.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 gb|ERN10517.1| hypothetical protein AMTR_s00166p00033330 [Ambore... 63 2e-08 ref|XP_022001039.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_021274313.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_006466653.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|ESR39065.1| hypothetical protein CICLE_v10024955mg [Citrus cl... 64 2e-08 gb|PKA48744.1| Pentatricopeptide repeat-containing protein [Apos... 64 2e-08 gb|KNA17414.1| hypothetical protein SOVF_080330, partial [Spinac... 64 3e-08 >ref|XP_020241415.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241416.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241417.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241418.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241420.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241421.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241422.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] ref|XP_020241423.1| pentatricopeptide repeat-containing protein At4g37170 [Asparagus officinalis] gb|ONK60141.1| uncharacterized protein A4U43_C08F14820 [Asparagus officinalis] Length = 629 Score = 128 bits (322), Expect = 9e-31 Identities = 66/105 (62%), Positives = 81/105 (77%), Gaps = 5/105 (4%) Frame = +2 Query: 338 PSFHLVIPESDPITYLVSKNQIQDAFTLCFRTLSLPSTQKLHSLIASVPYSIVICNRLID 517 PSF+ + DPIT L ++N+IQ+AF+LC RT SL S KL SLI+++P+SI + NRLID Sbjct: 6 PSFNASNSKPDPITNLFTQNRIQEAFSLCLRTRSLSSAHKLRSLISTLPHSITLTNRLID 65 Query: 518 LYSKCGSLSYARNLFDEMPTRDLCSYYTLIKVYSA-----QARNL 637 LYSKCGS S+ARN+FDEMPTRDLCSY TLIK YS+ QAR L Sbjct: 66 LYSKCGSPSHARNMFDEMPTRDLCSYNTLIKAYSSASDLNQARKL 110 >ref|XP_020681538.1| pentatricopeptide repeat-containing protein At4g37170 [Dendrobium catenatum] gb|PKU69747.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 666 Score = 70.9 bits (172), Expect = 1e-10 Identities = 46/124 (37%), Positives = 62/124 (50%), Gaps = 2/124 (1%) Frame = +2 Query: 254 ASSSPTTCQQTTASPSPLMTNMKAKAHAPSFHLVIPESDPITYLVSKNQIQDAFTLCFRT 433 A+S P C + PSP + P ++ I L +AF C R Sbjct: 21 AASVPAPC---SCPPSP--------SFFPEAETTSCSTESIDALCRHGFFHEAFDQCLRL 69 Query: 434 LSLPSTQKLHSLIASVPYS--IVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSYYTLI 607 SL + ++LHS + S P++ + NRLI Y KCGSL AR +FDEMP RD CS+ TL+ Sbjct: 70 RSLKAARRLHSHLRSPPFNPPTTLFNRLIYAYCKCGSLVDARKMFDEMPHRDTCSFNTLM 129 Query: 608 KVYS 619 YS Sbjct: 130 AGYS 133 >ref|XP_010523919.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Tarenaya hassleriana] Length = 693 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +2 Query: 422 CFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSY 595 C R +L +K+H I + +VICNRL+D+Y+KCGSL AR LFDEM +RDLCS+ Sbjct: 97 CCRIRALEEGKKVHEHIKRCGFVPGVVICNRLLDMYAKCGSLLDARKLFDEMSSRDLCSW 156 Query: 596 YTLIKVYS 619 T+IK Y+ Sbjct: 157 NTMIKGYA 164 >ref|XP_009408591.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Musa acuminata subsp. malaccensis] Length = 665 Score = 69.3 bits (168), Expect = 4e-10 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 13/130 (10%) Frame = +2 Query: 272 TCQQTTASPSPLMTNMKAKAHAPSFHLVIPESDPITYLVSKNQIQDAFTL---------- 421 T ++ +S S +K+ PSF L P+ D I++L ++ + DA L Sbjct: 5 TSRRRFSSASAAAVPSPSKSPPPSFSLTPPQ-DTISHLCAQGRFGDAIALLSRQRRLLPA 63 Query: 422 CFRTLSLPSTQKLHSLIASV---PYSIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 R L LPS+ + A+ P +++ NRL+DL +KCG L AR FD MP RDLCS Sbjct: 64 AHRPLDLPSSACRVAAAAAASGRPLGLLLSNRLLDLLAKCGVLPEARRWFDSMPYRDLCS 123 Query: 593 YYTLIKVYSA 622 + TLI YS+ Sbjct: 124 WNTLIGGYSS 133 >ref|XP_020577272.1| pentatricopeptide repeat-containing protein At4g37170-like [Phalaenopsis equestris] Length = 371 Score = 67.0 bits (162), Expect = 2e-09 Identities = 37/98 (37%), Positives = 57/98 (58%), Gaps = 7/98 (7%) Frame = +2 Query: 365 SDPITYLVSKNQIQDAFTLCFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGS 538 ++ I L +++ +AF C S+ + ++LH + S S +CNRL+ LY KCG+ Sbjct: 44 AESIDTLCHQHRFHEAFDHCLHLRSIKAARRLHWNLRSTLLHPSTALCNRLLHLYCKCGN 103 Query: 539 LSYARNLFDEMPTRDLCSYYTLIKVYS-----AQARNL 637 L AR LFD+MP RD CS+ T++ YS A+AR + Sbjct: 104 LVDARKLFDDMPHRDTCSFNTIMAGYSIAGHLAEARRI 141 >ref|XP_023750633.1| pentatricopeptide repeat-containing protein At2g21090 [Lactuca sativa] gb|PLY95451.1| hypothetical protein LSAT_8X124920 [Lactuca sativa] Length = 610 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/70 (42%), Positives = 48/70 (68%), Gaps = 2/70 (2%) Frame = +2 Query: 416 TLCFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLC 589 T+C +T L T+++H + + + +IV+C+ +ID YSKCG + ARNLFDEMP RD+ Sbjct: 190 TVCIQTKELKLTKQVHCQVFHLGFLSNIVLCSSIIDSYSKCGEIHNARNLFDEMPKRDVL 249 Query: 590 SYYTLIKVYS 619 S+ T++ Y+ Sbjct: 250 SWTTIVSAYA 259 >ref|XP_007047157.2| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Theobroma cacao] Length = 684 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPYS--IVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 LC + +L + +H I +S +VICNRL+D+Y+KCGSL+ A+N+FDEM RDLCS Sbjct: 87 LCCQNRALNEGKSVHQHIKISGFSAGLVICNRLLDMYAKCGSLADAQNVFDEMSERDLCS 146 Query: 593 YYTLIKVYS 619 + TL+ Y+ Sbjct: 147 WNTLMSGYA 155 >gb|EOX91314.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 684 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPYS--IVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 LC + +L + +H I +S +VICNRL+D+Y+KCGSL+ A+N+FDEM RDLCS Sbjct: 87 LCCQNRALNEGKSVHQHIKISGFSAGLVICNRLLDMYAKCGSLADAQNVFDEMSERDLCS 146 Query: 593 YYTLIKVYS 619 + TL+ Y+ Sbjct: 147 WNTLMSGYA 155 >gb|PKA53904.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 664 Score = 66.2 bits (160), Expect = 5e-09 Identities = 40/87 (45%), Positives = 52/87 (59%), Gaps = 3/87 (3%) Frame = +2 Query: 371 PITYLVSKNQIQDAFTLCFRTLSLPSTQKLHSLIAS---VPYSIVICNRLIDLYSKCGSL 541 PI L S+ + +AF C R S+ ++LHSLI+S VP + + NRLI LY KC SL Sbjct: 48 PIDALCSQRRFHEAFDHCLRLRSIEDARRLHSLISSSLSVPPTSLF-NRLIYLYCKCCSL 106 Query: 542 SYARNLFDEMPTRDLCSYYTLIKVYSA 622 AR FDEM D CS+ T+I Y+A Sbjct: 107 PEARKAFDEMAHPDTCSFNTIIAGYTA 133 >ref|XP_020099587.1| pentatricopeptide repeat-containing protein At4g37170-like [Ananas comosus] Length = 656 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +2 Query: 473 ASVPYSIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSYYTLIKVYS 619 +S+P ++ NRLIDL++K G+LS AR LFDE+P RDLCSY TL+ YS Sbjct: 73 SSIPVDTLLANRLIDLFAKLGALSDARRLFDELPHRDLCSYNTLVSAYS 121 >gb|OAY75655.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 656 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +2 Query: 473 ASVPYSIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSYYTLIKVYS 619 +S+P ++ NRLIDL++K G+LS AR LFDE+P RDLCSY TL+ YS Sbjct: 73 SSIPVDTLLANRLIDLFAKLGALSDARRLFDELPHRDLCSYNTLVSAYS 121 >gb|PIA47212.1| hypothetical protein AQUCO_01400121v1 [Aquilegia coerulea] Length = 712 Score = 65.5 bits (158), Expect = 9e-09 Identities = 36/71 (50%), Positives = 45/71 (63%), Gaps = 4/71 (5%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLI----ASVPYSIVICNRLIDLYSKCGSLSYARNLFDEMPTRDL 586 LCF L +++H LI A VP + I NRL+DLYSKCG L ARN FDEM RD+ Sbjct: 114 LCFDLRDLKLAKRIHDLINKTSAFVP-GVFISNRLLDLYSKCGCLISARNAFDEMCERDI 172 Query: 587 CSYYTLIKVYS 619 CS+ T+I Y+ Sbjct: 173 CSWNTMISGYA 183 >ref|XP_018472342.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Raphanus sativus] ref|XP_018472352.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Raphanus sativus] Length = 695 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 2/69 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 +C + +L +K+H I + + IVICNRL+ +YSKCGSL AR +FDEMP RD+CS Sbjct: 96 ICTQKRALEEGKKVHQHIRASGFVPGIVICNRLMGMYSKCGSLVDARKVFDEMPRRDVCS 155 Query: 593 YYTLIKVYS 619 + ++ Y+ Sbjct: 156 WNVIVSGYA 164 >gb|ERN10517.1| hypothetical protein AMTR_s00166p00033330 [Amborella trichopoda] Length = 240 Score = 63.2 bits (152), Expect = 2e-08 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 6/111 (5%) Frame = +2 Query: 305 LMTNMKAKAH--APSFHLVIPESDPITYLVSKNQIQDAFTL--CFRTLSLPSTQKLHSLI 472 + T++K H A SF+ + + P+ N F L C LSLP ++H I Sbjct: 77 IKTHVKNSLHTQALSFYAAMTATTPL----KPNNFTFPFLLNSCAALLSLPRGSEIHGRI 132 Query: 473 ASVPYSIV--ICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSYYTLIKVYS 619 +S+ + N LID+Y+KCG+L +AR FDEMP RD+ S+ L+ Y+ Sbjct: 133 VKTGFSLYLPVKNALIDMYAKCGNLLFARLAFDEMPQRDIVSFNALLSAYA 183 >ref|XP_022001039.1| pentatricopeptide repeat-containing protein At4g37170 [Helianthus annuus] gb|OTG01531.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 678 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPYSIVIC--NRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 LC + +L T+++HS I + + + NR++D+Y KCGSL AR +FDEMP RDLCS Sbjct: 81 LCVQQRALEGTKRVHSHIKRSNFLLGVSSYNRILDIYCKCGSLVDARKVFDEMPERDLCS 140 Query: 593 YYTLIKVYSAQAR 631 + T++ Y+ R Sbjct: 141 WNTMVSGYAKAGR 153 >ref|XP_021274313.1| pentatricopeptide repeat-containing protein At4g37170 [Herrania umbratica] Length = 684 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 2/69 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 LC + +L + +H I + +VICNRL+D+Y+KCGSL A+N+FDEM +DLCS Sbjct: 87 LCCQNRALNEGKSVHQHIKISGFLPGLVICNRLLDMYAKCGSLVDAQNVFDEMSEKDLCS 146 Query: 593 YYTLIKVYS 619 + TLI Y+ Sbjct: 147 WNTLISGYA 155 >ref|XP_006466653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 [Citrus sinensis] ref|XP_006425825.2| pentatricopeptide repeat-containing protein At4g37170 [Citrus clementina] Length = 695 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 7/79 (8%) Frame = +2 Query: 422 CFRTLSLPSTQKLHSLIASVPYS--IVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSY 595 C + +L +K+HS + S + + I N L+D+Y+KCG+LS AR LFDEM RD+CSY Sbjct: 99 CRQNRALEEGKKVHSHLKSSGFKPGVFISNCLLDMYAKCGNLSDARTLFDEMHERDVCSY 158 Query: 596 YTLIKVYS-----AQARNL 637 T+I Y+ QARNL Sbjct: 159 NTMISGYTKVGFLEQARNL 177 >gb|ESR39065.1| hypothetical protein CICLE_v10024955mg [Citrus clementina] Length = 759 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 7/79 (8%) Frame = +2 Query: 422 CFRTLSLPSTQKLHSLIASVPYS--IVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCSY 595 C + +L +K+HS + S + + I N L+D+Y+KCG+LS AR LFDEM RD+CSY Sbjct: 163 CRQNRALEEGKKVHSHLKSSGFKPGVFISNCLLDMYAKCGNLSDARTLFDEMHERDVCSY 222 Query: 596 YTLIKVYS-----AQARNL 637 T+I Y+ QARNL Sbjct: 223 NTMISGYTKVGFLEQARNL 241 >gb|PKA48744.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 766 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/90 (38%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +2 Query: 368 DPITYLVSKNQIQDAFTLCFRTLSLPSTQKLHSLIA--SVPYSIVICNRLIDLYSKCGSL 541 DP + +SK A T+ ++P +KLH+LI ++P + N LI+ Y KCGS+ Sbjct: 61 DPDEFSISK-----ALTVAANFGAMPEGRKLHALIVKRNLPMDVAATNSLINFYCKCGSI 115 Query: 542 SYARNLFDEMPTRDLCSYYTLIKVYSAQAR 631 ARN+FDEMP RD+ S+ L+ Y+ + R Sbjct: 116 VDARNVFDEMPERDVFSWTVLVSGYALKGR 145 >gb|KNA17414.1| hypothetical protein SOVF_080330, partial [Spinacia oleracea] Length = 648 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = +2 Query: 419 LCFRTLSLPSTQKLHSLIASVPY--SIVICNRLIDLYSKCGSLSYARNLFDEMPTRDLCS 592 +C + SL +++H I + + + I NRL+D+Y +CGSLS A+ +FDEMP RDLCS Sbjct: 51 ICLQQRSLNEGRRVHDHIKASGFVPGVFISNRLMDMYVRCGSLSDAQKVFDEMPERDLCS 110 Query: 593 YYTLIKVY 616 + T+IK Y Sbjct: 111 WNTMIKGY 118