BLASTX nr result
ID: Ophiopogon22_contig00012594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00012594 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254930.1| putative pentatricopeptide repeat-containing... 82 2e-14 ref|XP_010914728.1| PREDICTED: putative pentatricopeptide repeat... 69 3e-10 ref|XP_009381122.1| PREDICTED: putative pentatricopeptide repeat... 59 2e-06 >ref|XP_020254930.1| putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Asparagus officinalis] gb|ONK78729.1| uncharacterized protein A4U43_C02F21820 [Asparagus officinalis] Length = 674 Score = 81.6 bits (200), Expect = 2e-14 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = +3 Query: 6 PNSYSYGSIIDALSSMGRLGELLDVVNECERKGIHINSGSNLKNESGITDSVVNS 170 PNSYSYGSIIDALSS GRLGE+LD V +CER+G+HIN+ S+L I DSVVNS Sbjct: 620 PNSYSYGSIIDALSSTGRLGEVLDAVTDCERRGVHINNASDLMTNYRIGDSVVNS 674 >ref|XP_010914728.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Elaeis guineensis] Length = 734 Score = 69.3 bits (168), Expect = 3e-10 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = +3 Query: 3 SPNSYSYGSIIDALSSMGRLGELLDVVNECERKGIHINSGSNLKNESGITDSVVNS 170 +PNSYSYGSII AL+S+G L E +++++C RKGI IN NLK ES ITD VVNS Sbjct: 679 TPNSYSYGSIIHALTSLGNLEEAQELISKCRRKGILINPIPNLKMESEITDRVVNS 734 >ref|XP_009381122.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Musa acuminata subsp. malaccensis] ref|XP_018678012.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Musa acuminata subsp. malaccensis] Length = 731 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = +3 Query: 3 SPNSYSYGSIIDALSSMGRLGELLDVVNECERKGIHINSGSNLKNESGITDSVVNS 170 +PNSYSY SI+D+L MG L E + +++CERKGI+++S S++K E VVNS Sbjct: 676 TPNSYSYDSIVDSLLCMGHLTEAQEFISKCERKGIYLSSPSSMKIEPENVGRVVNS 731