BLASTX nr result
ID: Ophiopogon22_contig00012472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00012472 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX78198.1| homeobox-leucine zipper protein HAT3-like [Trifol... 62 1e-09 gb|AAA32817.1| homeobox protein, partial [Arabidopsis thaliana] 58 5e-09 pir||C44088 homeotic protein HAT22 - Arabidopsis thaliana (fragm... 58 8e-09 ref|XP_018810776.1| PREDICTED: homeobox-leucine zipper protein H... 58 2e-08 gb|AAS68138.1| homeodomain leucine zipper protein 11, partial [O... 58 2e-08 emb|CAK18868.1| type II homeodomain-leucine zipper protein precu... 58 3e-08 ref|XP_020256349.1| LOW QUALITY PROTEIN: homeobox-leucine zipper... 60 3e-08 dbj|BAF25932.1| Os10g0103700, partial [Oryza sativa Japonica Gro... 57 3e-08 gb|ABQ57264.1| hox1, partial [Oryza sativa Indica Group] 58 4e-08 gb|AET83222.1| hypothetical protein, partial [Pinus contorta var... 58 4e-08 gb|AET83216.1| hypothetical protein, partial [Pinus contorta var... 58 4e-08 ref|XP_002968858.1| hypothetical protein SELMODRAFT_6792, partia... 58 4e-08 gb|EPS66266.1| hypothetical protein M569_08512, partial [Genlise... 58 4e-08 gb|AEW08278.1| hypothetical protein 2_5173_01, partial [Pinus ra... 58 5e-08 gb|PIN15591.1| hypothetical protein CDL12_11764 [Handroanthus im... 58 5e-08 ref|XP_020257891.1| homeobox-leucine zipper protein HOX19-like i... 59 5e-08 ref|XP_015689823.1| PREDICTED: homeobox-leucine zipper protein H... 58 5e-08 ref|XP_020257890.1| homeobox-leucine zipper protein HOX19-like i... 59 5e-08 gb|AAS68140.1| homeodomain leucine zipper protein 27, partial [O... 56 6e-08 gb|PNS98081.1| hypothetical protein POPTR_016G058400v3 [Populus ... 58 6e-08 >gb|PNX78198.1| homeobox-leucine zipper protein HAT3-like [Trifolium pratense] Length = 129 Score = 61.6 bits (148), Expect = 1e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 110 LVSLIFFRTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 L +F RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 10 LCKFLFHRTKLKQTEVDCEYLKRCCETLTEENRRLQ 45 >gb|AAA32817.1| homeobox protein, partial [Arabidopsis thaliana] Length = 56 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LK+CCETL DENRRLQ Sbjct: 12 RTKLKQTEVDCEFLKKCCETLTDENRRLQ 40 >pir||C44088 homeotic protein HAT22 - Arabidopsis thaliana (fragments) Length = 73 Score = 58.2 bits (139), Expect = 8e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LK+CCETL DENRRLQ Sbjct: 29 RTKLKQTEVDCEFLKKCCETLTDENRRLQ 57 >ref|XP_018810776.1| PREDICTED: homeobox-leucine zipper protein HAT22-like, partial [Juglans regia] Length = 103 Score = 58.2 bits (139), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LK+CCETL DENRRLQ Sbjct: 10 RTKLKQTEVDCEFLKKCCETLTDENRRLQ 38 >gb|AAS68138.1| homeodomain leucine zipper protein 11, partial [Oryza sativa Japonica Group] dbj|BAF25225.1| Os09g0447000, partial [Oryza sativa Japonica Group] dbj|BAT08351.1| Os09g0447000, partial [Oryza sativa Japonica Group] Length = 90 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 48 RTKLKQTEVDCEYLKRCCETLTEENRRLQ 76 >emb|CAK18868.1| type II homeodomain-leucine zipper protein precursor, partial [Phillyrea latifolia] Length = 106 Score = 57.8 bits (138), Expect = 3e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 18 RTKLKQTEVDCEYLKRCCETLTEENRRLQ 46 >ref|XP_020256349.1| LOW QUALITY PROTEIN: homeobox-leucine zipper protein HAT22-like, partial [Asparagus officinalis] Length = 251 Score = 60.1 bits (144), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRL 6 RTKLKQTEVDCEVLKRCCETL DENRRL Sbjct: 154 RTKLKQTEVDCEVLKRCCETLSDENRRL 181 >dbj|BAF25932.1| Os10g0103700, partial [Oryza sativa Japonica Group] dbj|BAT09581.1| Os10g0103700, partial [Oryza sativa Japonica Group] Length = 74 Score = 56.6 bits (135), Expect = 3e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRL 6 RTKLKQTEVDCE+LKRCCETL +ENRRL Sbjct: 10 RTKLKQTEVDCELLKRCCETLTEENRRL 37 >gb|ABQ57264.1| hox1, partial [Oryza sativa Indica Group] Length = 139 Score = 58.2 bits (139), Expect = 4e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRL 6 RTKLKQTEVDCE+LKRCCETL DENRRL Sbjct: 98 RTKLKQTEVDCELLKRCCETLTDENRRL 125 >gb|AET83222.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83233.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83250.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83254.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83257.1| hypothetical protein, partial [Pinus contorta var. bolanderi] Length = 123 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCEVLKRCCE L +ENRRLQ Sbjct: 39 RTKLKQTEVDCEVLKRCCENLTEENRRLQ 67 >gb|AET83216.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83217.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83218.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83219.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83220.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83221.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83223.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83224.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83225.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83226.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83227.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83228.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83229.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83230.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83231.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83232.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83234.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83235.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83236.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83237.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83238.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83239.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83240.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83241.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83242.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83243.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83244.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83245.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83246.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83247.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83248.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83249.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83251.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83252.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83253.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83255.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83256.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83258.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83259.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83260.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83261.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gb|AET83262.1| hypothetical protein, partial [Pinus contorta var. murrayana] gb|AET83263.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83264.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83265.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83266.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83267.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83268.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83269.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83270.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83271.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83272.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83273.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83274.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83275.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83276.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83277.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83278.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83279.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83280.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83281.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83282.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83283.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83284.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83285.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83286.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83287.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83288.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83289.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83290.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83291.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83292.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83293.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83294.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83295.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83296.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83297.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83298.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83299.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83300.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83301.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83302.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83303.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83304.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83305.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83306.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83307.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gb|AET83308.1| hypothetical protein, partial [Pinus contorta var. murrayana] Length = 123 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCEVLKRCCE L +ENRRLQ Sbjct: 39 RTKLKQTEVDCEVLKRCCENLTEENRRLQ 67 >ref|XP_002968858.1| hypothetical protein SELMODRAFT_6792, partial [Selaginella moellendorffii] ref|XP_002974113.1| hypothetical protein SELMODRAFT_6791, partial [Selaginella moellendorffii] gb|EFJ25068.1| hypothetical protein SELMODRAFT_6791, partial [Selaginella moellendorffii] gb|EFJ29974.1| hypothetical protein SELMODRAFT_6792, partial [Selaginella moellendorffii] Length = 140 Score = 58.2 bits (139), Expect = 4e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTE+DCE+LKRCCETL +ENRRLQ Sbjct: 66 RTKLKQTEIDCELLKRCCETLTEENRRLQ 94 >gb|EPS66266.1| hypothetical protein M569_08512, partial [Genlisea aurea] Length = 132 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL DENRRL+ Sbjct: 68 RTKLKQTEVDCEYLKRCCETLTDENRRLK 96 >gb|AEW08278.1| hypothetical protein 2_5173_01, partial [Pinus radiata] gb|AFG58027.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58028.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58029.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58030.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58031.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58032.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58033.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58034.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58035.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58036.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58037.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58038.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58039.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58040.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58041.1| hypothetical protein 2_5173_01, partial [Pinus taeda] gb|AFG58042.1| hypothetical protein 2_5173_01, partial [Pinus taeda] Length = 133 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCEVLKRCCE L +ENRRLQ Sbjct: 44 RTKLKQTEVDCEVLKRCCENLTEENRRLQ 72 >gb|PIN15591.1| hypothetical protein CDL12_11764 [Handroanthus impetiginosus] Length = 138 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 35 RTKLKQTEVDCEYLKRCCETLTEENRRLQ 63 >ref|XP_020257891.1| homeobox-leucine zipper protein HOX19-like isoform X2 [Asparagus officinalis] Length = 232 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL DENRRLQ Sbjct: 153 RTKLKQTEVDCEFLKRCCETLTDENRRLQ 181 >ref|XP_015689823.1| PREDICTED: homeobox-leucine zipper protein HOX19-like, partial [Oryza brachyantha] Length = 141 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 63 RTKLKQTEVDCEFLKRCCETLTEENRRLQ 91 >ref|XP_020257890.1| homeobox-leucine zipper protein HOX19-like isoform X1 [Asparagus officinalis] gb|ONK76116.1| uncharacterized protein A4U43_C03F24070 [Asparagus officinalis] Length = 235 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL DENRRLQ Sbjct: 156 RTKLKQTEVDCEFLKRCCETLTDENRRLQ 184 >gb|AAS68140.1| homeodomain leucine zipper protein 27, partial [Oryza sativa Japonica Group] Length = 66 Score = 55.8 bits (133), Expect = 6e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRL 6 RTKLKQTEVDCE LKRCCETL +ENRRL Sbjct: 27 RTKLKQTEVDCEYLKRCCETLTEENRRL 54 >gb|PNS98081.1| hypothetical protein POPTR_016G058400v3 [Populus trichocarpa] Length = 144 Score = 57.8 bits (138), Expect = 6e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 RTKLKQTEVDCEVLKRCCETLGDENRRLQ 3 RTKLKQTEVDCE LKRCCETL +ENRRLQ Sbjct: 29 RTKLKQTEVDCEYLKRCCETLTEENRRLQ 57