BLASTX nr result
ID: Ophiopogon22_contig00012068
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00012068 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67294.1| uncharacterized protein A4U43_C06F18660 [Asparagu... 55 2e-06 ref|XP_020268801.1| K(+) efflux antiporter 3, chloroplastic [Asp... 55 5e-06 >gb|ONK67294.1| uncharacterized protein A4U43_C06F18660 [Asparagus officinalis] Length = 204 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 CRLDTGNGSSSNEEDVKNINMSDSSVPFAGKSEG 102 CRLD NGSSSNEED++NI M DSSVP+ KSEG Sbjct: 170 CRLDMSNGSSSNEEDMENIGMLDSSVPYTSKSEG 203 >ref|XP_020268801.1| K(+) efflux antiporter 3, chloroplastic [Asparagus officinalis] Length = 813 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 CRLDTGNGSSSNEEDVKNINMSDSSVPFAGKSEG 102 CRLD NGSSSNEED++NI M DSSVP+ KSEG Sbjct: 779 CRLDMSNGSSSNEEDMENIGMLDSSVPYTSKSEG 812