BLASTX nr result
ID: Ophiopogon22_contig00009878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009878 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243711.1| uncharacterized protein LOC109821969 [Aspara... 55 6e-06 >ref|XP_020243711.1| uncharacterized protein LOC109821969 [Asparagus officinalis] Length = 352 Score = 54.7 bits (130), Expect = 6e-06 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = -1 Query: 366 FASAPGHIRRDCRRANGACLVCGSMEHKAAQCPN 265 F S PGH+ +DCRRANG CL CG+++H+ + CP+ Sbjct: 296 FCSKPGHLMKDCRRANGLCLACGAVDHQLSTCPS 329