BLASTX nr result
ID: Ophiopogon22_contig00009306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009306 (1056 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021639589.1| thioredoxin-like protein CXXS1 [Hevea brasil... 61 8e-08 ref|XP_021666794.1| thioredoxin-like protein CXXS1 [Hevea brasil... 60 1e-07 ref|XP_009419595.1| PREDICTED: thioredoxin-like protein CXXS1 [M... 60 1e-07 ref|XP_021596332.1| thioredoxin-like protein CXXS1 [Manihot escu... 60 2e-07 gb|AAD33596.1|AF133127_1 thioredoxin h [Hevea brasiliensis] 60 2e-07 gb|AFP49341.1| thioredoxin h, partial [Olea europaea] 59 3e-07 ref|XP_002304983.1| Thioredoxin-like 4 family protein [Populus t... 59 4e-07 ref|XP_022848424.1| thioredoxin-like protein CXXS1 [Olea europae... 59 4e-07 ref|XP_022848423.1| thioredoxin-like protein CXXS1 [Olea europae... 59 5e-07 ref|XP_012091425.1| thioredoxin-like protein CXXS1 [Jatropha cur... 58 7e-07 gb|OMO64943.1| Thioredoxin [Corchorus olitorius] 58 1e-06 ref|XP_022036986.1| thioredoxin-like protein CXXS1 [Helianthus a... 58 1e-06 ref|XP_012841645.1| PREDICTED: thioredoxin-like protein CXXS1 [E... 57 1e-06 ref|XP_020103358.1| thioredoxin-like protein CXXS1 [Ananas comos... 58 1e-06 gb|KNA04080.1| hypothetical protein SOVF_202990 [Spinacia oleracea] 57 1e-06 gb|PKU81323.1| Thioredoxin-like protein CXXS1 [Dendrobium catena... 56 1e-06 gb|PKA63703.1| Thioredoxin-like protein CXXS1 [Apostasia shenzhe... 57 2e-06 gb|KHN33611.1| Thioredoxin-like protein CXXS1 [Glycine soja] 57 2e-06 ref|NP_001235589.1| uncharacterized protein LOC100500012 [Glycin... 57 2e-06 gb|OMO76684.1| Thioredoxin [Corchorus capsularis] 57 2e-06 >ref|XP_021639589.1| thioredoxin-like protein CXXS1 [Hevea brasiliensis] Length = 125 Score = 60.8 bits (146), Expect = 8e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 K+EVKAMPTFVLMKDGA + RLVGANPEEIKKR+ Sbjct: 80 KLEVKAMPTFVLMKDGAQIDRLVGANPEEIKKRI 113 >ref|XP_021666794.1| thioredoxin-like protein CXXS1 [Hevea brasiliensis] Length = 132 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRMSQ 108 K+EVKAMPTFVLMKDGA + RLVGANPEEI+KR+ + Sbjct: 87 KLEVKAMPTFVLMKDGAQVDRLVGANPEEIRKRIDE 122 >ref|XP_009419595.1| PREDICTED: thioredoxin-like protein CXXS1 [Musa acuminata subsp. malaccensis] Length = 134 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTFVLM+DGAV+ ++VGANPEEI+KR+ Sbjct: 87 KMEVKAMPTFVLMRDGAVLDKIVGANPEEIRKRI 120 >ref|XP_021596332.1| thioredoxin-like protein CXXS1 [Manihot esculenta] gb|OAY26044.1| hypothetical protein MANES_16G017200 [Manihot esculenta] Length = 125 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 K+EVKAMPTFVLMKDGA + RLVGANPEEI+KR+ Sbjct: 80 KLEVKAMPTFVLMKDGAQIDRLVGANPEEIRKRI 113 >gb|AAD33596.1|AF133127_1 thioredoxin h [Hevea brasiliensis] Length = 125 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 K+EVKAMPTFVLMKDGA + RLVGANPEEI+KR+ Sbjct: 80 KLEVKAMPTFVLMKDGAQIDRLVGANPEEIRKRI 113 >gb|AFP49341.1| thioredoxin h, partial [Olea europaea] Length = 100 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KME+KAMPTF+ MK+GAV+ +LVGANPEEIKKR+ Sbjct: 62 KMEIKAMPTFLFMKEGAVVDKLVGANPEEIKKRV 95 >ref|XP_002304983.1| Thioredoxin-like 4 family protein [Populus trichocarpa] gb|PNT39318.1| hypothetical protein POPTR_004G031700v3 [Populus trichocarpa] Length = 125 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTFVLMKDGA + ++VGANPEEI+KR+ Sbjct: 80 KMEVKAMPTFVLMKDGAQVDKIVGANPEEIRKRI 113 >ref|XP_022848424.1| thioredoxin-like protein CXXS1 [Olea europaea var. sylvestris] Length = 118 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KME+KAMPTF+ MK+GAV+ +LVGANPEEIKKR+ Sbjct: 80 KMEIKAMPTFLFMKEGAVVDKLVGANPEEIKKRV 113 >ref|XP_022848423.1| thioredoxin-like protein CXXS1 [Olea europaea var. sylvestris] Length = 121 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KME+KAMPTF+ MK+GAV+ +LVGANPEEIKKR+ Sbjct: 80 KMEIKAMPTFLFMKEGAVVDKLVGANPEEIKKRV 113 >ref|XP_012091425.1| thioredoxin-like protein CXXS1 [Jatropha curcas] gb|KDP20821.1| hypothetical protein JCGZ_21292 [Jatropha curcas] Length = 125 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 K+EVKAMPTFVLMK+GA + RLVGANPEEI+KR+ Sbjct: 80 KLEVKAMPTFVLMKEGAQVDRLVGANPEEIRKRI 113 >gb|OMO64943.1| Thioredoxin [Corchorus olitorius] Length = 125 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTFVLM++G V+ +LVGANPEEI+KR+ Sbjct: 80 KMEVKAMPTFVLMREGTVVDKLVGANPEEIRKRV 113 >ref|XP_022036986.1| thioredoxin-like protein CXXS1 [Helianthus annuus] gb|OTG23900.1| putative thioredoxin-like protein [Helianthus annuus] Length = 126 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 K EVKAMPTF+L+K+G V+GRLVGANP+EIKKR+ Sbjct: 81 KYEVKAMPTFLLIKEGVVVGRLVGANPDEIKKRI 114 >ref|XP_012841645.1| PREDICTED: thioredoxin-like protein CXXS1 [Erythranthe guttata] gb|EYU33596.1| hypothetical protein MIMGU_mgv1a016570mg [Erythranthe guttata] Length = 116 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KME+KAMPTFVLMKDG V+ +L+GANP+E+ KR+ Sbjct: 78 KMEIKAMPTFVLMKDGVVVDKLIGANPDEVNKRV 111 >ref|XP_020103358.1| thioredoxin-like protein CXXS1 [Ananas comosus] gb|OAY74942.1| Thioredoxin-like protein CXXS1 [Ananas comosus] Length = 130 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKK 96 K+EVKAMPTFVLMKDG V+ ++VGANPEEIKK Sbjct: 84 KLEVKAMPTFVLMKDGQVLNKIVGANPEEIKK 115 >gb|KNA04080.1| hypothetical protein SOVF_202990 [Spinacia oleracea] Length = 95 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTF+LMK+G+V+ +LVGANP+EI+KR+ Sbjct: 48 KMEVKAMPTFLLMKNGSVVDKLVGANPDEIRKRV 81 >gb|PKU81323.1| Thioredoxin-like protein CXXS1 [Dendrobium catenatum] Length = 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTF+++KDG + ++VGANPEEIKKR+ Sbjct: 31 KMEVKAMPTFIIIKDGTPVDKMVGANPEEIKKRI 64 >gb|PKA63703.1| Thioredoxin-like protein CXXS1 [Apostasia shenzhenica] Length = 120 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KM+VKAMPTFV+MKDGAV+ ++VGAN EEI+KR+ Sbjct: 78 KMDVKAMPTFVIMKDGAVLNKMVGANSEEIRKRV 111 >gb|KHN33611.1| Thioredoxin-like protein CXXS1 [Glycine soja] Length = 124 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KM+VKAMPTF+L+KDGA + ++VGANPEEIKKR+ Sbjct: 79 KMDVKAMPTFLLLKDGAAVDKVVGANPEEIKKRI 112 >ref|NP_001235589.1| uncharacterized protein LOC100500012 [Glycine max] gb|ACU14593.1| unknown [Glycine max] gb|KRH10686.1| hypothetical protein GLYMA_15G063100 [Glycine max] Length = 124 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KM+VKAMPTF+L+KDGA + ++VGANPEEIKKR+ Sbjct: 79 KMDVKAMPTFLLLKDGAAVDKVVGANPEEIKKRI 112 >gb|OMO76684.1| Thioredoxin [Corchorus capsularis] Length = 125 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 1 KMEVKAMPTFVLMKDGAVMGRLVGANPEEIKKRM 102 KMEVKAMPTFV M++GAV +LVGANPEEI+KR+ Sbjct: 80 KMEVKAMPTFVFMREGAVADKLVGANPEEIRKRI 113