BLASTX nr result
ID: Ophiopogon22_contig00008913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008913 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81910.1| uncharacterized protein A4U43_C01F34180 [Asparagu... 57 5e-07 ref|XP_020267707.1| uncharacterized protein LOC109843154 [Aspara... 57 1e-06 >gb|ONK81910.1| uncharacterized protein A4U43_C01F34180 [Asparagus officinalis] Length = 219 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 464 ERLLRPSMVKVSAGPGPEKSVEDETLPVDDGVPPSGKEQ 348 ERLLRPSMVKVSAGPGP+KS ED P D+G+ P KE+ Sbjct: 167 ERLLRPSMVKVSAGPGPDKSDEDPIPPADEGISPVVKEE 205 >ref|XP_020267707.1| uncharacterized protein LOC109843154 [Asparagus officinalis] Length = 333 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 464 ERLLRPSMVKVSAGPGPEKSVEDETLPVDDGVPPSGKEQ 348 ERLLRPSMVKVSAGPGP+KS ED P D+G+ P KE+ Sbjct: 281 ERLLRPSMVKVSAGPGPDKSDEDPIPPADEGISPVVKEE 319