BLASTX nr result
ID: Ophiopogon22_contig00007765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00007765 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255681.1| ethylene-responsive transcription factor RAP... 70 4e-11 >ref|XP_020255681.1| ethylene-responsive transcription factor RAP2-4-like [Asparagus officinalis] gb|ONK74013.1| uncharacterized protein A4U43_C03F1900 [Asparagus officinalis] Length = 320 Score = 70.1 bits (170), Expect = 4e-11 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 137 PLQSHQNQIFDQSSPSRSNLLSLEQPDLSQLGPIGLAQLSPLQIQ 3 PL S QN FD SSPS S+LLS++QPDLSQ+GP+GL QLSPLQIQ Sbjct: 59 PLPSFQNPTFDHSSPSNSSLLSMDQPDLSQVGPVGLTQLSPLQIQ 103