BLASTX nr result
ID: Ophiopogon22_contig00007173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00007173 (666 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU20280.1| hypothetical protein TSUD_337610 [Trifolium subt... 61 2e-08 gb|KHG07590.1| creC [Gossypium arboreum] 62 1e-07 gb|KHG22746.1| creC [Gossypium arboreum] 62 1e-07 gb|KHG07589.1| creC [Gossypium arboreum] 62 1e-07 ref|XP_020247621.1| probable catabolite repression protein creC ... 61 3e-07 ref|XP_017187348.1| PREDICTED: WD repeat-containing protein 20-l... 61 3e-07 gb|ESR42042.1| hypothetical protein CICLE_v10013583mg, partial [... 60 3e-07 ref|XP_017187347.1| PREDICTED: WD repeat-containing protein 20-l... 61 4e-07 gb|KDO44234.1| hypothetical protein CISIN_1g0089391mg, partial [... 60 4e-07 ref|XP_021806773.1| dystrophia myotonica WD repeat-containing pr... 61 4e-07 ref|XP_008243924.1| PREDICTED: WD repeat-containing protein 20 [... 61 4e-07 ref|XP_003554372.1| PREDICTED: dystrophia myotonica WD repeat-co... 61 4e-07 gb|KHN02346.1| WD repeat-containing protein 20 [Glycine soja] 61 4e-07 gb|KDO44235.1| hypothetical protein CISIN_1g0089391mg, partial [... 60 4e-07 gb|PKI68153.1| hypothetical protein CRG98_011452 [Punica granatum] 60 4e-07 gb|KCW49742.1| hypothetical protein EUGRSUZ_K03239 [Eucalyptus g... 60 5e-07 gb|OWM69727.1| hypothetical protein CDL15_Pgr025576 [Punica gran... 60 5e-07 gb|KRH67678.1| hypothetical protein GLYMA_03G180100 [Glycine max] 60 5e-07 ref|XP_008387605.2| PREDICTED: dystrophia myotonica WD repeat-co... 60 5e-07 dbj|GAY53348.1| hypothetical protein CUMW_148610 [Citrus unshiu] 60 5e-07 >dbj|GAU20280.1| hypothetical protein TSUD_337610 [Trifolium subterraneum] Length = 138 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAWRS 633 GYLRVF Y+K QLICG KSYYG LLCCAWRS Sbjct: 76 GYLRVFDYAKEQLICGGKSYYGGLLCCAWRS 106 >gb|KHG07590.1| creC [Gossypium arboreum] Length = 485 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAWR 630 GYLRVF YSK QL+CG KSYYGALLCCAWR Sbjct: 291 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 320 >gb|KHG22746.1| creC [Gossypium arboreum] Length = 497 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAWR 630 GYLRVF YSK QL+CG KSYYGALLCCAWR Sbjct: 288 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 317 >gb|KHG07589.1| creC [Gossypium arboreum] Length = 506 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAWR 630 GYLRVF YSK QL+CG KSYYGALLCCAWR Sbjct: 312 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 341 >ref|XP_020247621.1| probable catabolite repression protein creC [Asparagus officinalis] gb|ONK56224.1| uncharacterized protein A4U43_C10F5400 [Asparagus officinalis] Length = 542 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAWRS 633 GYLRVF YSK QL+CG KSYYGALLCCAW S Sbjct: 314 GYLRVFDYSKEQLVCGGKSYYGALLCCAWSS 344 >ref|XP_017187348.1| PREDICTED: WD repeat-containing protein 20-like [Malus domestica] Length = 351 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 S+L +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 116 SYLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 153 >gb|ESR42042.1| hypothetical protein CICLE_v10013583mg, partial [Citrus clementina] Length = 288 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 61 GYLRVFDYSKEQLICGGKSYYGALLCCAW 89 >ref|XP_017187347.1| PREDICTED: WD repeat-containing protein 20-like [Malus domestica] Length = 532 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 S+L +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 297 SYLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 334 >gb|KDO44234.1| hypothetical protein CISIN_1g0089391mg, partial [Citrus sinensis] Length = 329 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 301 GYLRVFDYSKEQLICGGKSYYGALLCCAW 329 >ref|XP_021806773.1| dystrophia myotonica WD repeat-containing protein [Prunus avium] Length = 546 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 +FL +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 310 AFLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 347 >ref|XP_008243924.1| PREDICTED: WD repeat-containing protein 20 [Prunus mume] Length = 546 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 +FL +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 310 AFLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 347 >ref|XP_003554372.1| PREDICTED: dystrophia myotonica WD repeat-containing protein-like [Glycine max] gb|KRG95970.1| hypothetical protein GLYMA_19G180800 [Glycine max] Length = 550 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 +FL +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 314 AFLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 351 >gb|KHN02346.1| WD repeat-containing protein 20 [Glycine soja] Length = 562 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 517 SFLIDLGF-GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 +FL +G GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 326 AFLATVGRDGYLRVFDYSKEQLICGGKSYYGALLCCAW 363 >gb|KDO44235.1| hypothetical protein CISIN_1g0089391mg, partial [Citrus sinensis] Length = 349 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 321 GYLRVFDYSKEQLICGGKSYYGALLCCAW 349 >gb|PKI68153.1| hypothetical protein CRG98_011452 [Punica granatum] Length = 401 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 326 GYLRVFDYSKEQLICGGKSYYGALLCCAW 354 >gb|KCW49742.1| hypothetical protein EUGRSUZ_K03239 [Eucalyptus grandis] Length = 434 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 335 GYLRVFDYSKEQLICGGKSYYGALLCCAW 363 >gb|OWM69727.1| hypothetical protein CDL15_Pgr025576 [Punica granatum] Length = 502 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 274 GYLRVFDYSKEQLICGGKSYYGALLCCAW 302 >gb|KRH67678.1| hypothetical protein GLYMA_03G180100 [Glycine max] Length = 519 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 323 GYLRVFDYSKEQLICGGKSYYGALLCCAW 351 >ref|XP_008387605.2| PREDICTED: dystrophia myotonica WD repeat-containing protein-like [Malus domestica] Length = 523 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 319 GYLRVFDYSKEQLICGGKSYYGALLCCAW 347 >dbj|GAY53348.1| hypothetical protein CUMW_148610 [Citrus unshiu] Length = 526 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 541 GYLRVFGYSKVQLICGWKSYYGALLCCAW 627 GYLRVF YSK QLICG KSYYGALLCCAW Sbjct: 299 GYLRVFDYSKEQLICGGKSYYGALLCCAW 327