BLASTX nr result
ID: Ophiopogon22_contig00006548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00006548 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIZ68162.1| polyadenylate-binding protein-interacting protein... 55 6e-06 >gb|AIZ68162.1| polyadenylate-binding protein-interacting protein 7-like isoform X2 [Ornithogalum longebracteatum] Length = 559 Score = 54.7 bits (130), Expect = 6e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 3 PRLSMAVEQVLLEEGLPYTHPQPGLLRAVIY 95 PRL MAVEQ L+EEGLPYT PQPGLL VIY Sbjct: 529 PRLPMAVEQFLIEEGLPYTQPQPGLLHVVIY 559