BLASTX nr result
ID: Ophiopogon22_contig00006227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00006227 (765 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245976.1| UPF0481 protein At3g47200-like [Asparagus of... 60 8e-07 >ref|XP_020245976.1| UPF0481 protein At3g47200-like [Asparagus officinalis] gb|ONK58366.1| uncharacterized protein A4U43_C09F11510 [Asparagus officinalis] Length = 441 Score = 60.5 bits (145), Expect = 8e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = +2 Query: 323 NSVGVLDQEWVRFLKEKVEVSNPNATGSTYPATTTIFRILEHIQQTNPSAYDPSIVSI 496 +S+ VLDQEWV+ K+K+ SNPN G T+ IFR+ +HI+ T+P+AY+P +VSI Sbjct: 7 HSIKVLDQEWVKSWKKKLRGSNPNNGG-----TSIIFRVSDHIRATDPNAYEPKVVSI 59