BLASTX nr result
ID: Ophiopogon22_contig00006199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00006199 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010941942.1| PREDICTED: formin-like protein 5 [Elaeis gui... 71 2e-12 ref|XP_008796990.1| PREDICTED: WAS/WASL-interacting protein fami... 69 5e-12 ref|XP_010942059.1| PREDICTED: uncharacterized protein LOC105060... 64 7e-11 ref|XP_020096297.1| uncharacterized protein LOC109715598 [Ananas... 63 2e-10 gb|OAY80503.1| hypothetical protein ACMD2_20003 [Ananas comosus] 63 3e-10 ref|XP_008812107.1| PREDICTED: pollen-specific leucine-rich repe... 61 1e-08 >ref|XP_010941942.1| PREDICTED: formin-like protein 5 [Elaeis guineensis] Length = 163 Score = 71.2 bits (173), Expect(2) = 2e-12 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPRA-VPPPQPAFQYN 198 VY EPRGFR+LVQKLTGAP+ RPLRD PPP L+LAPR +PPPQP F N Sbjct: 51 VYRVEPRGFRQLVQKLTGAPRP--TPRPLRDTARPPPALNLAPRTPLPPPQPIFDNN 105 Score = 28.1 bits (61), Expect(2) = 2e-12 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 171 WSSFPLLSPGTMASL 127 W SFPLLSPG++A L Sbjct: 141 WCSFPLLSPGSIAPL 155 >ref|XP_008796990.1| PREDICTED: WAS/WASL-interacting protein family member 1-like [Phoenix dactylifera] Length = 164 Score = 69.3 bits (168), Expect(2) = 5e-12 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPRA-VPPPQPAFQYN 198 VY +PRGFR+LVQ LTGAP RPLR PPPPLDLAPR +PPPQP F N Sbjct: 51 VYRVDPRGFRQLVQMLTGAPPPTP--RPLRSTARPPPPLDLAPRTPLPPPQPMFDNN 105 Score = 28.9 bits (63), Expect(2) = 5e-12 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -3 Query: 171 WSSFPLLSPGTMASL 127 W SFPLLSPG++A+L Sbjct: 142 WCSFPLLSPGSIATL 156 >ref|XP_010942059.1| PREDICTED: uncharacterized protein LOC105060151 [Elaeis guineensis] Length = 172 Score = 63.9 bits (154), Expect(2) = 7e-11 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPRA-VPPPQPAF-QYNC 195 VY +PR FR+LVQKLTGAP+ RPLRD PPPPL L PR +PPP P F NC Sbjct: 59 VYRVDPRDFRQLVQKLTGAPQ--ATPRPLRDTARPPPPLVLTPRTPLPPPLPVFDNSNC 115 Score = 30.4 bits (67), Expect(2) = 7e-11 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 171 WSSFPLLSPGTMASL 127 W SFPLLSPG+MA+L Sbjct: 150 WCSFPLLSPGSMATL 164 >ref|XP_020096297.1| uncharacterized protein LOC109715598 [Ananas comosus] Length = 192 Score = 63.2 bits (152), Expect(2) = 2e-10 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPRAVPPPQPAFQ 204 VY EPRGFR+LVQ+LTGAPK R L++M+ PPPPL+L P PP P F+ Sbjct: 84 VYFVEPRGFRELVQRLTGAPK-----RSLKEMVQPPPPLELEPPPPPPLLPTFR 132 Score = 30.0 bits (66), Expect(2) = 2e-10 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 171 WSSFPLLSPGTMASL*LCKSPIL 103 W SFPLLSP +MASL P+L Sbjct: 170 WCSFPLLSPASMASLEHNGEPVL 192 >gb|OAY80503.1| hypothetical protein ACMD2_20003 [Ananas comosus] Length = 322 Score = 63.2 bits (152), Expect(2) = 3e-10 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPRAVPPPQPAFQ 204 VY EPRGFR+LVQ+LTGAPK R L++M+ PPPPL+L P PP P F+ Sbjct: 62 VYFVEPRGFRELVQRLTGAPK-----RSLKEMVQPPPPLELEPPPPPPLLPTFR 110 Score = 29.3 bits (64), Expect(2) = 3e-10 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 171 WSSFPLLSPGTMASL 127 W SFPLLSP +MASL Sbjct: 148 WCSFPLLSPSSMASL 162 >ref|XP_008812107.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 3 [Phoenix dactylifera] Length = 157 Score = 61.2 bits (147), Expect = 1e-08 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -1 Query: 365 VYHCEPRGFRKLVQKLTGAPKKAVAVRPLRDMLVPPPPLDLAPR-AVPPPQP 213 VY +PR FR+LVQKLTGAP+ RPL+D PPPPL LAPR +PPP P Sbjct: 40 VYRVDPRDFRQLVQKLTGAPQS--TPRPLKDTARPPPPLLLAPRNPLPPPPP 89