BLASTX nr result
ID: Ophiopogon22_contig00004916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004916 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS58199.1| Dihydroflavonol-4-reductase [Triticum urartu] 57 1e-07 gb|EMS57378.1| Dihydroflavonol-4-reductase [Triticum urartu] 57 1e-07 dbj|BAJ87977.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 2e-07 gb|PNT74809.1| hypothetical protein BRADI_1g22260v3 [Brachypodiu... 59 4e-07 ref|XP_003559994.1| PREDICTED: vestitone reductase [Brachypodium... 59 4e-07 dbj|BAJ98263.1| predicted protein, partial [Hordeum vulgare subs... 57 4e-07 ref|XP_003562747.1| PREDICTED: dihydroflavonol-4-reductase-like ... 58 7e-07 ref|XP_020162698.1| protein BRI1-5 ENHANCED 1-like, partial [Aeg... 55 7e-07 ref|XP_020161210.1| dihydroflavonol 4-reductase-like isoform X2 ... 57 9e-07 ref|XP_020200438.1| anthocyanidin reductase ((2S)-flavan-3-ol-fo... 57 1e-06 ref|XP_020161209.1| anthocyanidin reductase ((2S)-flavan-3-ol-fo... 57 1e-06 ref|XP_020198205.1| uncharacterized protein LOC109784013 [Aegilo... 56 1e-06 ref|XP_020161211.1| anthocyanidin reductase ((2S)-flavan-3-ol-fo... 57 2e-06 ref|XP_015647360.1| PREDICTED: anthocyanidin reductase [Oryza sa... 57 2e-06 ref|XP_003562745.1| PREDICTED: vestitone reductase [Brachypodium... 57 2e-06 dbj|BAF22116.1| Os07g0601900 [Oryza sativa Japonica Group] >gi|2... 56 2e-06 dbj|BAJ94753.1| predicted protein [Hordeum vulgare subsp. vulgar... 56 3e-06 gb|EEE67539.1| hypothetical protein OsJ_25017 [Oryza sativa Japo... 56 3e-06 gb|EEC82395.1| hypothetical protein OsI_26761 [Oryza sativa Indi... 56 3e-06 gb|OEL35479.1| Anthocyanidin reductase [Dichanthelium oligosanthes] 56 3e-06 >gb|EMS58199.1| Dihydroflavonol-4-reductase [Triticum urartu] Length = 130 Score = 57.4 bits (137), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 47 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 87 >gb|EMS57378.1| Dihydroflavonol-4-reductase [Triticum urartu] Length = 131 Score = 57.4 bits (137), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 75 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 115 >dbj|BAJ87977.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 161 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 47 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 87 >gb|PNT74809.1| hypothetical protein BRADI_1g22260v3 [Brachypodium distachyon] Length = 329 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQ 118 L GA +RLVLF+A+I AD FEPAI GCEFVFLVA P+Q Sbjct: 42 LPGAPERLVLFEADIYDADSFEPAIAGCEFVFLVATPLQ 80 >ref|XP_003559994.1| PREDICTED: vestitone reductase [Brachypodium distachyon] Length = 335 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQ 118 L GA +RLVLF+A+I AD FEPAI GCEFVFLVA P+Q Sbjct: 42 LPGAPERLVLFEADIYDADSFEPAIAGCEFVFLVATPLQ 80 >dbj|BAJ98263.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 201 Score = 57.4 bits (137), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 47 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 87 >ref|XP_003562747.1| PREDICTED: dihydroflavonol-4-reductase-like [Brachypodium distachyon] gb|KQK15374.1| hypothetical protein BRADI_1g22280v3 [Brachypodium distachyon] Length = 335 Score = 57.8 bits (138), Expect = 7e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDTQNL 139 L GA +RLVLFQA+I A FEPAI GCEFVFLVA P+Q + T + Sbjct: 48 LPGAAERLVLFQADIYDAATFEPAIAGCEFVFLVATPLQHDPTSTM 93 >ref|XP_020162698.1| protein BRI1-5 ENHANCED 1-like, partial [Aegilops tauschii subsp. tauschii] ref|XP_020161915.1| protein BRI1-5 ENHANCED 1-like, partial [Aegilops tauschii subsp. tauschii] Length = 100 Score = 54.7 bits (130), Expect = 7e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDTQN 136 L GA +RLVLF+A+I A FEPAI+GCEFVFL+A P+ + DT + Sbjct: 53 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLIATPL-LQDTSS 96 >ref|XP_020161210.1| dihydroflavonol 4-reductase-like isoform X2 [Aegilops tauschii subsp. tauschii] Length = 303 Score = 57.4 bits (137), Expect = 9e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 83 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 123 >ref|XP_020200438.1| anthocyanidin reductase ((2S)-flavan-3-ol-forming)-like [Aegilops tauschii subsp. tauschii] Length = 345 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 47 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 87 >ref|XP_020161209.1| anthocyanidin reductase ((2S)-flavan-3-ol-forming)-like isoform X1 [Aegilops tauschii subsp. tauschii] Length = 375 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q N Sbjct: 83 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQHN 123 >ref|XP_020198205.1| uncharacterized protein LOC109784013 [Aegilops tauschii subsp. tauschii] Length = 222 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDTQNLKVLT*RS 160 L GA +RLVLF+A+I A FEPAI+GCEFVFL+A P+ + DT + + RS Sbjct: 53 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLIATPL-LQDTSSTSAASSRS 104 >ref|XP_020161211.1| anthocyanidin reductase ((2S)-flavan-3-ol-forming)-like [Aegilops tauschii subsp. tauschii] Length = 335 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDTQNLK 142 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+ ++DT + K Sbjct: 47 LPGAAERLVLFEADIYDAATFEPAIQGCEFVFLVATPL-LHDTSSTK 92 >ref|XP_015647360.1| PREDICTED: anthocyanidin reductase [Oryza sativa Japonica Group] dbj|BAC79711.1| putative NADPH HC toxin reductase [Oryza sativa Japonica Group] dbj|BAC81168.1| putative NADPH HC toxin reductase [Oryza sativa Japonica Group] dbj|BAF22113.1| Os07g0601000 [Oryza sativa Japonica Group] gb|EEE67535.1| hypothetical protein OsJ_25013 [Oryza sativa Japonica Group] dbj|BAT02522.1| Os07g0601000 [Oryza sativa Japonica Group] Length = 338 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 8 GAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDT 130 GA +RLVLF+A++ AD FEPAI GCEFVFLVA P+Q + T Sbjct: 49 GAAERLVLFEADMYDADTFEPAIAGCEFVFLVATPMQHDPT 89 >ref|XP_003562745.1| PREDICTED: vestitone reductase [Brachypodium distachyon] gb|KQK15373.1| hypothetical protein BRADI_1g22270v3 [Brachypodium distachyon] Length = 338 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQIN 124 L GA +RLVLF+A+I A FEPAI GCEFVFLVA P+Q N Sbjct: 47 LPGATERLVLFEADIYDAASFEPAIAGCEFVFLVATPLQHN 87 >dbj|BAF22116.1| Os07g0601900 [Oryza sativa Japonica Group] dbj|BAG97296.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAT02525.1| Os07g0601900 [Oryza sativa Japonica Group] Length = 224 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQ 118 L GA +RLVLF+A++ AD FEPAI GCEFVFL+A P+Q Sbjct: 52 LPGAAERLVLFEADMYDADTFEPAIAGCEFVFLLATPLQ 90 >dbj|BAJ94753.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ96401.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ97503.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 342 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQ 118 L GA +RLVLF+A+I A FEPAI+GCEFVFLVA P+Q Sbjct: 47 LPGAAERLVLFEADIYDAASFEPAIQGCEFVFLVATPLQ 85 >gb|EEE67539.1| hypothetical protein OsJ_25017 [Oryza sativa Japonica Group] Length = 279 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQ 118 L GA +RLVLF+A++ AD FEPAI GCEFVFL+A P+Q Sbjct: 52 LPGAAERLVLFEADMYDADTFEPAIAGCEFVFLLATPLQ 90 >gb|EEC82395.1| hypothetical protein OsI_26761 [Oryza sativa Indica Group] Length = 337 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDT 130 L GA +RLVLF+A++ AD FEPAI GCEFVFLVA P+ + T Sbjct: 47 LPGAAERLVLFEADMYDADTFEPAIAGCEFVFLVATPLHHDPT 89 >gb|OEL35479.1| Anthocyanidin reductase [Dichanthelium oligosanthes] Length = 340 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +2 Query: 2 LSGAEDRLVLFQANI*SADEFEPAIRGCEFVFLVAAPVQINDTQNLK 142 L GA +RL LFQAN+ AD FEPAI GCEFVFL+A P+ ++D + K Sbjct: 48 LPGAAERLRLFQANMYDADSFEPAIAGCEFVFLIATPL-VHDPTSTK 93