BLASTX nr result
ID: Ophiopogon22_contig00004629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004629 (678 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BBC66038.1| hypothetical protein MMRN_29340 [Mycobacterium m... 58 3e-06 >dbj|BBC66038.1| hypothetical protein MMRN_29340 [Mycobacterium marinum] Length = 522 Score = 58.2 bits (139), Expect = 3e-06 Identities = 42/127 (33%), Positives = 57/127 (44%), Gaps = 1/127 (0%) Frame = +3 Query: 42 TLQDHH*SKLHTLAMCRIWHTSSRHNTNITPYGHNNPHTAQNQHLT-SIHHTTPQHMTYY 218 TL HH + T+ ++ H ++ HN NIT Y H+ PHT L + HT P Y Sbjct: 340 TLLGHHHT---TIPDDQLHHLTTNHNNNITLYQHHQPHTYTGPTLLIAAEHTPPPTTPYE 396 Query: 219 VKPTPSRTQTHKRQLHHQPHSLTIPRSQTHLQLRHPNTTPKTASTATLHPSHQAHQSVTK 398 T + H Q H + T + TH QL HPN TP T +T+ S Q + + Sbjct: 397 STHTKAAYLLHAWQPHLTGPTTTHSTNSTHHQLLHPNHTPPTPTTS--KTSSNDTQVIQR 454 Query: 399 SHRINKL 419 H N L Sbjct: 455 RHLRNGL 461