BLASTX nr result
ID: Ophiopogon22_contig00004607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004607 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247681.1| uncharacterized protein At5g48480 [Asparagus... 62 2e-09 gb|ONK56787.1| uncharacterized protein A4U43_C10F12920 [Asparagu... 59 3e-08 ref|XP_008776121.1| PREDICTED: uncharacterized protein At5g48480... 55 2e-06 ref|XP_010908197.1| PREDICTED: uncharacterized protein At5g48480... 55 2e-06 >ref|XP_020247681.1| uncharacterized protein At5g48480 [Asparagus officinalis] Length = 159 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 RKADQELPPVLCAELKIGGSSFLVCDQTDD 91 RKADQE+PPVLCAELK+GGS FLVCDQTDD Sbjct: 56 RKADQEIPPVLCAELKVGGSCFLVCDQTDD 85 >gb|ONK56787.1| uncharacterized protein A4U43_C10F12920 [Asparagus officinalis] Length = 116 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 8 ADQELPPVLCAELKIGGSSFLVCDQTDD 91 ADQE+PPVLCAELK+GGS FLVCDQTDD Sbjct: 15 ADQEIPPVLCAELKVGGSCFLVCDQTDD 42 >ref|XP_008776121.1| PREDICTED: uncharacterized protein At5g48480-like [Phoenix dactylifera] Length = 163 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 RKADQELPPVLCAELKIGGSSFLVCDQTDDS 94 RKA+QELP +LCAELKIG SS LVCDQT+DS Sbjct: 55 RKAEQELPLILCAELKIGSSSLLVCDQTEDS 85 >ref|XP_010908197.1| PREDICTED: uncharacterized protein At5g48480-like [Elaeis guineensis] Length = 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 RKADQELPPVLCAELKIGGSSFLVCDQTDDS 94 RKA+QELP +LCAELKIG SS LVCDQT+DS Sbjct: 55 RKAEQELPLILCAELKIGSSSLLVCDQTEDS 85